KEGG   T30319 (Metagenome): 1004
Entry
1004              CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
spy:SPy_1754 (best score: 268.855)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.1004-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1133:3..626
AA seq 208 aa
ISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLIAK
AGITGEELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKF
IASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGGVLLEASEQEHFLAESLNSDGSR
SECLTYGHSGLHSPFSDQESADSFLKMD

KEGG   T30319 (Metagenome): 15579
Entry
15579             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rmu:RMDY18_11730 (best score: 222.631)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.15579-T1-C
LinkDB
Position
C473786:complement(3..419)
AA seq 139 aa
STRHRASENQTVNDLAIAAAHDALANSHVMGEQIDAVIISTISHPYATPSLAVLVADAIG
SRCPAYDISAACAGFCYGIAQADAMVRSGMAQNVLVIGVEKLSDFIDNTERSISFLLGDG
AGAAVVGVSDEPGIAPTIW

KEGG   T30319 (Metagenome): 10077
Entry
10077             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rpne:NCTC8284_01059 (best score: 178.718)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.10077-T1-C
LinkDB
Position
C460550:3..308
AA seq 102 aa
ALLLPQAERGVEKSGYIEMQGNETFKLAVRELSNVVEETLSANNLQKTDIDWLVPHQANL
RIITATAKKLEMDMSQVVVTLDRTANTSAATVPTALDEAVRD

KEGG   T30319 (Metagenome): 211
Entry
211               CDS       T30319                                 

Gene name
fabH2
Definition
3-oxoacyl-(acyl-carrier-protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lba:Lebu_1735 (best score: 167.548)
Taxonomy
Fusobacteria [GN:lba]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.211-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_272:complement(3..410)
AA seq 136 aa
MKGKKTMTEVKRHVEIAGYGICLPKHTVQFKDQTRYRVVENEETQLDLAEGAIHRALEHA
NLDIKDIDCLVSASAVGVQPIPCTAALIHERVAKGLSIPAMDINTTCTSFISALSTMSHL
IEADEYNRVLIVSSEV

KEGG   T30319 (Metagenome): 17399
Entry
17399             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
hin:HI_0157 (best score: 144.05)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.17399-T1-C
LinkDB
Position
C477925:complement(3..257)
AA seq 85 aa
MMNSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAADETVATMGCEAA
KKALEMANLDPQEIELIIVATTSGS

KEGG   T30319 (Metagenome): 7358
Entry
7358              CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rmu:RMDY18_11730 (best score: 649.047)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.7358-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6500:complement(503..1528)
AA seq 341 aa
VTTLKQYEINRYSRILGYGAARGEVIVPNDDIVEAIDSSDEWIKQRTGIATRHRASENQS
VADLAIGAAKDALEASGVTGEDIEAVIISTISHPYATPSLATLVADAIGSKCPAYDISAA
CAGFCYGIAQADALVRAGTAKHVLVIGVEKLSDFIDNTERTISFLLGDGAGAAVVGVSDE
PGIAPTVWGSDGSRWGTVGMTHSLLDIRNRDFVANPVEESEKIWPTLRQDGPSVFRWAVW
EMAKVAKQALETAGITPDELGALIPHQANARIIDQMVKTLKLPDTVAVARDIVDAGNTSA
ASVPLAAHRLLKENPELSGKFALQIGFGAGLAFAAQVVVLP

KEGG   T30319 (Metagenome): 5149
Entry
5149              CDS       T30319                                 

Gene name
fabH2
Definition
3-oxoacyl-(acyl-carrier-protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lgo:JCM16774_1410 (best score: 245.358)
Taxonomy
Fusobacteria [GN:lgo]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.5149-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4978:3..578
AA seq 191 aa
LIVSSEVGSLGLNPKQKESFELFSDGAAAFIFQKSHQEKGVIASLQRTWSEGAHDTEIRG
GLTSFQPKEYSEATKTNYMFDMKGKKILLLSARKIPVMFEEFQEKTQLALADVDYIIPHQ
ASRALPLVMEKLGVAEDQYLNLVTDYGNMVSVSVPFGLAYSLEHGLIKEGDVVYLMGTAA
GMTVNMLALKL

KEGG   T30319 (Metagenome): 21729
Entry
21729             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lla:L0182 (best score: 370.163)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.21729-T1-C
LinkDB
Position
C487313:160..1017
AA seq 286 aa
MAFAKISQVAHYAPEQIITNEDLAQVMDTSDEWISSRTGIKERHISKTESTGDLATEVAK
QLLEKAGISAEELDFIIIATMTPDSMMPSTAARVQAKIGAHKAFAYDLTAACSGFVFALS
TAEKFISSGTYRKGLVIGSETMSKSLDWSDRSTAVLFGDGAGGVLLEASDQKHFLAESLN
SDGSRGECLTYGQTGLISPFSIQEEPDVFLKMDGRAVFDFAIRDVAKSIKQTIEKSPISA
DELDYLLLHQANIRILDKMAKKIGVDRDKLPANMMKYGNTSAASIP

KEGG   T30319 (Metagenome): 16887
Entry
16887             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
rmu:RMDY18_11730 (best score: 183.341)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.16887-T1-C
LinkDB
Position
C476832:complement(155..463)
AA seq 102 aa
WEMAKVAQQALESAGITPDELGALIPHQANARIIDQMAKTLKLPENVAIARDIADAGNTS
AASVPLAAHRLLQEQPELSGKFALQIGFGAGLAYAAQVVVLP

KEGG   T30319 (Metagenome): 2765
Entry
2765              CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
spy:SPy_1754 (best score: 114.775)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.2765-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2909:149..391
AA seq 81 aa
MAFAKISQVAHYVPEQVVTNHDLAQIMDTSDEWISSRTGIKQRHISKTESTSDLATEVAK
SLLAKGSLTADQIDFIIVATI

KEGG   T30319 (Metagenome): 13284
Entry
13284             CDS       T30319                                 

Gene name
fabH
Definition
3-oxoacyl-[acyl-carrier-protein] synthase 3
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Best hit
lla:L0182 (best score: 171.4)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.13284-T1-C
LinkDB
Position
C468319:complement(1..360)
AA seq 120 aa
IIVATITPDSLMPSTAARVQANIGANNAFAFDLTAACSGFIFALSTGEKFISSGRYQKGL
VIGSETLSKTVDWSDRSTAVLFGDGAGGVLLESASEQHFLAESQFTDGSRGDSLTCGKIG

DBGET integrated database retrieval system