KEGG   T30319 (Metagenome): 10139
Entry
10139             CDS       T30319                                 

Definition
putative transcriptional regulator, gntR family protein
  KO
K05825  2-aminoadipate transaminase [EC:2.6.1.-]
Best hit
ane:AN27039_1017 (best score: 130.954)
Taxonomy
Actinobacteria [GN:ane]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01210  2-Oxocarboxylic acid metabolism
Other DBs
HMP: SRS016533.10139-T1-C
LinkDB
Position
C460692:complement(122..310)
AA seq 62 aa
GGRAGQDHLRLSFCYPEPTEIREGVRRLSGVVTRDLELLSLFGPTHSPHPSEGVHAPAPD
QI

DBGET integrated database retrieval system