KEGG   T30319 (Metagenome): 10521
Entry
10521             CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
spn:SP_1811 (best score: 195.282)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.10521-T1-C
LinkDB
Position
C461612:3..314
AA seq 104 aa
EHANFVEPFLADTDMALIPLVSLTTGLERQKELIKGAEGFVYAVAINGVTGKSGNYRADL
DKHLAQLHQVADIPVLTGFGVSSQEDVERFNAVSDGVIVGSKIV

KEGG   T30319 (Metagenome): 18608
Entry
18608             CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08290 (best score: 109.768)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.18608-T1-C
LinkDB
Position
C480693:3..227
AA seq 74 aa
RTSVSEAAQGLVENLHAAGAEYACVGLGVSTRAHVEEIGTYADGVIVGTALVKALADGGP
TAVGALTRELAGRA

KEGG   T30319 (Metagenome): 20045
Entry
20045             CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0826 (best score: 422.935)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.20045-T1-C
LinkDB
Position
C483837:3..671
AA seq 223 aa
DRSFEIICTLVENGADALELGFPFSDPLLDGPVIQAANNRALNAGHSTEDSFKLLAKVRS
KYPEIPISLLLCANLIFAKGLDNFYQRCAEVGVDAVLVADIPLLAKEDYVQAAKKHGIQP
VFICPPNADVKTVQGVAENSEGYTYLVSRAGVTSAENQAHAANLDTLVEQLKTHKAPAIL
QGFGIAQPAQVKEALQLGAAGAISGSATVKIIERNLDNQAQCL

KEGG   T30319 (Metagenome): 3267
Entry
3267              CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0826 (best score: 482.256)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.3267-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3381:767..1525
AA seq 253 aa
MSRFETKFAELAAKKEGAFVPFVTLCDPTFDRSFEIICTLVENGADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLAKVRSKYPEIPISLLLCANLIFAKGLDNFYQRCAE
VGVDAVLVADIPLLAKEDYIQAAKKHGIQPVFICPPNADAKTVQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHKAPPILQGFGIAQPAQVKEALQLGAAGAISGSATVK
IIERNLDNQAQCL

KEGG   T30319 (Metagenome): 5829
Entry
5829              CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
spn:SP_1811 (best score: 199.904)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.5829-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5549:complement(2..355)
AA seq 118 aa
KTAWKQMQQRREKLMPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLAGLGETIHFLEDL
GVSAIEVGIPFSDPVADGPVIEEAGLRSLAHGTSTQTLVETLKTIETEVPLVIMTYFN

KEGG   T30319 (Metagenome): 6334
Entry
6334              CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08290 (best score: 136.346)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.6334-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5924:complement(2..229)
AA seq 76 aa
MDGPVIQHATGAALEGGFKLSRVFDAVRRITEATQAVVVVMTYWNPVLAYGVDNFARDLA
AAGGAGMITPDLVPDE

KEGG   T30319 (Metagenome): 9161
Entry
9161              CDS       T30319                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08290 (best score: 546.584)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.9161-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7141:1683..2537
AA seq 284 aa
MSYQDAISQAAPFTVLDGSFPAPNAQSPLAARLAECEKQGRAALIGYLPVGFPTLDESID
AAIALGNNGADIIELGVPYSDPVMDGPVIQKATGVALENGFKLPQLFEAVRRITEATDAV
VVVMTYWNPVLAYGVKNFARDLAAAGGAGMITPDLVPDEASSWFEASDEYGLDRIFLAAL
SSSPERLATIAKASSGFVYAVSVMGVTGARTSVSEAARTLVADIKAAGAPRACVGLGVST
RAHVEEIGAYADGVIVGTALVKALASGGVEAVAKLTRELAGREG

DBGET integrated database retrieval system