KEGG   T30319 (Metagenome): 11173
Entry
11173             CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
gsa:FOC50_03835 (best score: 161.384)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.11173-T1-C
LinkDB
Position
C463218:complement(2..253)
AA seq 84 aa
MTNLENNLNNLKGYFGEFGGSFVPEVVQKALDELEAAYDKYKDDEEFLAEYAHYLKDYSG
RETPLYYAETLTNHLGGAKIYLKR

KEGG   T30319 (Metagenome): 13535
Entry
13535             CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 245.743)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.13535-T1-C
LinkDB
Position
C468937:complement(2..367)
AA seq 122 aa
THYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGRLPDAVIAAVGGGSNAIGMFTD
FLDEKNVRLIGVEPAGHGIESGEHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYSISAG
LD

KEGG   T30319 (Metagenome): 17326
Entry
17326             CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08280 (best score: 257.684)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.17326-T1-C
LinkDB
Position
C477773:75..479
AA seq 135 aa
MSENLADAFLEGKSLKNAPGPYFGQYGGRWMPESLIAAMDELESTFQNAKQDPEFIAEFQ
RLSAEYSNRPSLLTEVPRFSEHAGARIFLKREDLNHTGSHKINNVLGQALLAKRMGKTRL
IAETGAGQHGVATAT

KEGG   T30319 (Metagenome): 19858
Entry
19858             CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
gsa:FOC50_03835 (best score: 417.542)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.19858-T1-C
LinkDB
Position
C483461:2..652
AA seq 217 aa
GVATAAAAAKFGMECEIYMGALDVERQRLNVFRMEMLGAKVHAAQEGEKTLKEAVDAAFK
AWIENIDDTFYVLGSAVGPHPYPTIVKDFQKVISQEAKRQILEKEGRLPDLVVACVGGGS
NAIGAFAEFIPHEEVALLGVEAAGRGLDTDRHAATLTLGTVGVVDGMKTYALFNEDGSVK
PVYSISPGLDYPGIGPEHSFLKDAKRAEYVSATDDEA

KEGG   T30319 (Metagenome): 3210
Entry
3210              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rpne:NCTC8284_02079 (best score: 290.041)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.3210-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3333:complement(2..427)
AA seq 142 aa
KNYAGRPTALTLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAE
TGAGQHGVATALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDA
CCEAMRDWSANYENTHYLLGTA

KEGG   T30319 (Metagenome): 3266
Entry
3266              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 494.582)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.3266-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3381:3..767
AA seq 254 aa
PNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSANYENTHYLLGTAAGPHPFPTIVRE
FQKMIGEETKRQILEKEGRLPDAVIAAVGGGSNAIGMFTDFIDEKGVRLIGVEPAGHGIE
SGEHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYSISAGLDFPSVGPQHAYLQSIGRAE
YPSITDDEALNAFQELAKHEGIIPALESSHALAHALKMIHQEPNKEQILVVNLSGRGDKD
IFTVDKVLKEKGMQ

KEGG   T30319 (Metagenome): 3268
Entry
3268              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
aap:NT05HA_0825 (best score: 295.049)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.3268-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3382:complement(2..451)
AA seq 150 aa
MSETLLNPYFGEFGGMYVPEILVLVLQQLEKAFVEAKDDPEFQREFQDLLKNYAGRPTAL
TLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRM

KEGG   T30319 (Metagenome): 3297
Entry
3297              CDS       T30319                                 

Definition
hypothetical protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
adc:FOC79_07740 (best score: 45.4394)
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.3297-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3411:1..78
AA seq 25 aa
IIIINVSGRGDKDVAAIADYLEAKK

KEGG   T30319 (Metagenome): 3309
Entry
3309              CDS       T30319                                 

Gene name
43
Definition
DNA polymerase
  KO
K18942  T4virus DNA polymerase [EC:2.7.7.7]
Best hit
vg:26623821 (best score: 446.432)
Taxonomy
Viruses [GN:vg]
Other DBs
HMP: SRS016533.3309-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3417:complement(3136..4764)
AA seq 542 aa
VNKFYSNVYSRGEYLYHRYFENGQDKIEKIQMQPWYFLNCNHETGYQDIYGNNVQRFDFN
SVKEYRDNRRLMIDANQEVLGQENLELLYLADLYPGPVSFDASKLRIASIDIETVSKNGF
PYPNEAKEEIDAISHIDSITGDIWLFSTRKWDRNKSTLSKEILNRAKYKYFNSEQEMLLD
YLTYWKSNYPHIVTGWNIDNYDIQYMVNRYNKLFGEKVTSNFSPFGFIGSRIAEGSSADD
EFPEKTYSFAGIAILDYLALYKKFRITARSSYKLDFIAELELGENKLEYDGPLWKLAEED
PQRYCDYNIQDTLLIEKLDNKLKFLLLAVSLSYYSHINFEKVLSPVTTWDGIIFNSLLNQ
NKIVPMKRSHPKETYVGAYVKEPKIGMRYGWIVSDDLTSLYPSIVRQWNISPETIAGRTD
YHSVEKYLNKEVKTSTEYAQAANGMLYRKDKRGIIPIEIEKVFFQRKHHKNNEFFAKKVN
ELIELSIKLYDKLPDDSELYCFEYVELSEQEIQSKISNMSKEDMSNAYKLIEKDFGILNK
FI

KEGG   T30319 (Metagenome): 6335
Entry
6335              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08280 (best score: 174.481)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.6335-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5924:complement(465..809)
AA seq 114 aa
LSDLGRVSYQPVTDTEAMDAFQLLCRTEGIIPAIESAHALAGALRVCQEWAHQDSESARE
KIMVVCLSGRGDKDMETALKWFDLGKATPSSSLMTGNKEAVAEKAVQAESEAHA

KEGG   T30319 (Metagenome): 9160
Entry
9160              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
rmu:RMDY18_08280 (best score: 843.573)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.9160-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7141:349..1683
AA seq 444 aa
MSENLADAFLNGESLKNAPGPYFGEYGGRWMPELLIAAMDELEATFNEAKNDPEFIAEFQ
RLSAEYSNRPSLLTEVPKFSEHAGARVFLKREDLNHTGSHKINNVIGQALLAKRMGKTRL
IAETGAGQHGVATATAAALFGMECVVYMGEEDTERQSLNVARMQLLGAKVIAVQNGSRTL
KDAINEALRDWVANVENTHYLLGTAAGAHPFPAMVRFFHDAIGSEAREQILAETGRLPDG
IAACVGGGSNAIGLFHAFLDDASVEIYGFEAGGDGVETGRHAATITLGRPGMLHGAMTYL
MQDEDGQTIESHSISAGLDYPGVGPEHSYLSDIGRVTYEPVTDTEAMDALRLLCRTEGII
PAIESSHALAGALRVCQRWAAEDPEAAREKTMIVCLSGRGDKDMETALKWFGLGKAIPSS
TLMTGNKEAAASAAQNAQAESEAK

KEGG   T30319 (Metagenome): 9748
Entry
9748              CDS       T30319                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Best hit
gsa:FOC50_03835 (best score: 160.999)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00260  Glycine, serine and threonine metabolism
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.9748-T1-C
LinkDB
Position
C459732:2..304
AA seq 101 aa
ATMTKGSVGIVDGMKTYAVFGEDGNVAPVYSISAGLDYPGVGPEHAFFKDSGRVEYVAAT
DEEAVQALLLLSKTEGIIPAIESSHAIAEAVKRAPKLSKDE

DBGET integrated database retrieval system