KEGG   T30319 (Metagenome): 12560
Entry
12560             CDS       T30319                                 

Gene name
trpF
Definition
fused indole-3-glycerolphosphate
synthetase/N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 194.897)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.12560-T1-C
LinkDB
Position
C466579:3..347
AA seq 115 aa
YANGALYGGLIFVEHSKRCVSLRQAQELVTASPLRFVGVFQNQEIDFIVKIAKQLQLYAV
QLHGSETAEFITALRHQLPEEIQIWKAISVSTEAQSAVDFTDNLNIARYIFDSQS

KEGG   T30319 (Metagenome): 2821
Entry
2821              CDS       T30319                                 

Gene name
trpF
Definition
fused indole-3-glycerolphosphate
synthetase/N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 266.544)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.2821-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2983:complement(3..458)
AA seq 152 aa
YANGALYGGLIFVEHSKRCVSLRQAQELVTASPLRFVGVFQNQEIDFIVKIAKQLQLYAV
QLHGSETAEFITALRHQLPEEIQIWKAISIDTETQSAVDFTDDLNIARYIFDSQSANQQG
GTGKTFNWSLIPENLKHKIILAGGISPDNIEQ

KEGG   T30319 (Metagenome): 4697
Entry
4697              CDS       T30319                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 285.034)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4697-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4614:573..1031
AA seq 153 aa
MITQDFTKPIDSATVLQKIVLDKAQWVKAKEAEFPLLQFKENIQKSDRSFYDALAKGTHQ
KPAYILECKKASPSKGLIRDEFNLDEIANVYKHYASAVSVLTDEKYFQGKFDYLPQVRDV
VSQPVLCKDFMISEYQVYLARYYQADAILLMLS

KEGG   T30319 (Metagenome): 5484
Entry
5484              CDS       T30319                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
hin:HI1389.1 (best score: 67.0106)
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.5484-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5257:complement(339..473)
AA seq 44 aa
SPDNIEQAIKQGCLGVDLNSGVETAAGVKDSEKVRSVFKTILSN

KEGG   T30319 (Metagenome): 5958
Entry
5958              CDS       T30319                                 

Gene name
trpC
Definition
fused indole-3-glycerolphosphate
synthetase/N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Best hit
rpne:NCTC8284_02081 (best score: 268.085)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00400  Phenylalanine, tyrosine and tryptophan biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.5958-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5639:complement(3..452)
AA seq 150 aa
AILLMLSVVNDETYRVLADLAHSLGMGVLTETSNEEEFERALALGAKIIGVNNRNLHDLT
VDLNRVVELTQKYADRIPTDARIISESGIYNHSQIRDLQKVAHGFLIGSSLMGSADLNNA
VREVIFGENKVCGLTRTQDVKEVYANGALY

DBGET integrated database retrieval system