KEGG   T30319 (Metagenome): 12696
Entry
12696             CDS       T30319                                 

Gene name
fabB
Definition
beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Best hit
pmu:PM0339 (best score: 199.134)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.12696-T1-C
LinkDB
Position
C466911:3..350
AA seq 116 aa
YAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAVELIQLGKQDVVFAGGAE
ELSWECATEFDAMGAVSTKYNDTPEKASRAYDANRDGFVIAGGGAVVVVEELEHAL

KEGG   T30319 (Metagenome): 12729
Entry
12729             CDS       T30319                                 

Gene name
fabB
Definition
beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Best hit
pmu:PM0339 (best score: 197.208)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.12729-T1-C
LinkDB
Position
C466987:complement(2..349)
AA seq 116 aa
YAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAVELIQLGKQDVVFAGGAE
ELSWECATEFDAMGAVSTKYNDTPEKASRAYDADRDGFVIAGGGAVVVVEELEHAL

KEGG   T30319 (Metagenome): 5887
Entry
5887              CDS       T30319                                 

Gene name
fabB
Definition
beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Best hit
rpne:NCTC8284_02833 (best score: 265.774)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.5887-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5598:43..453
AA seq 137 aa
MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMKMRSHVAGTIKLDPSEHI
DRKVYRFMGDAAAYAYLSMREAIEDSGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR
GPRGVKAIGPYAVTKTM

KEGG   T30319 (Metagenome): 21180
Entry
21180             CDS       T30319                                 

Gene name
fabB
Definition
beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Best hit
hin:HI1533 (best score: 325.479)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.21180-T1-C
LinkDB
Position
C486229:3..500
AA seq 165 aa
LEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTST
PVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINIE
KLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYNG

KEGG   T30319 (Metagenome): 3221
Entry
3221              CDS       T30319                                 

Gene name
fabB
Definition
beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Best hit
hin:HI1533 (best score: 327.791)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.3221-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3342:complement(535..1032)
AA seq 165 aa
LEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTST
PVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINIE
TLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYNG

DBGET integrated database retrieval system