KEGG   T30319 (Metagenome): 13275
Entry
13275             CDS       T30319                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 177.948)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.13275-T1-C
LinkDB
Position
C468301:1..360
AA seq 120 aa
AGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADKVWMLENS
IYAVLSPEGFASILWKDGSRAMEAAELMKITSHELLNMDIVDKVIPEHGFSNGELLAQVK

KEGG   T30319 (Metagenome): 14958
Entry
14958             CDS       T30319                                 

Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 143.665)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.14958-T1-C
LinkDB
Position
C472353:complement(1..282)
AA seq 94 aa
MNIAKIVREAREQTRLTALDFATGIFDDFVELHGDRSFRDDGAVIGGIGWLGDQAVTVVG
IQKGKSLQDNLNRNFGQPHPEGYRKALRLMKQAE

KEGG   T30319 (Metagenome): 321
Entry
321               CDS       T30319                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 157.532)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.321-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_392:3..326
AA seq 108 aa
IAWRKSRMNIAKIVREAREQSRLTALDFANGIFDEFIELHGDRSFRDDGAVIGGIGWLGE
QAVTVVGIQKGKSLHDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVV

KEGG   T30319 (Metagenome): 16756
Entry
16756             CDS       T30319                                 

Definition
acetyl-coA carboxylase, carboxytransferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
paet:NCTC13378_01074 (best score: 280.411)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.16756-T1-C
LinkDB
Position
C476510:complement(2..457)
AA seq 152 aa
HIFTDFQELAGDRAFADDKAIVGGLARLDGRSVMVIGHQKGRTVKDKVARNFGMPAPEGY
RKALRLMQMAERFNLPIITFIDTPGAYPGIGAEERGQSEAIARNLREMSTLKVPVICTVI
GEGGSGGALAIGVGDKVNMLQYSTYSVISPEG

KEGG   T30319 (Metagenome): 10618
Entry
10618             CDS       T30319                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 61.6178)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.10618-T1-C
LinkDB
Position
C461868:complement(1..117)
AA seq 39 aa
MTRITQIIKEARDQGRLTALDYAHGIFENFIELHGDRNF

KEGG   T30319 (Metagenome): 4745
Entry
4745              CDS       T30319                                 

Gene name
accA
Definition
acetyl-coA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
rpne:NCTC8284_01263 (best score: 521.161)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.4745-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4647:complement(2..898)
AA seq 299 aa
MSQEYLDFELPIAELEAKIEALRSASDDKIDLHDEIKRLQKKSDELTKKTFANLDAWQVS
RMARHPNRPYTLDYIEHIFTDFQELAGDRAFADDKAIVGGLARLDGRAVMVIGHQKGRTV
KDKVTRNFGMPAPEGYRKALRLMQMAERFNLPIITFIDTPGAYPGIGAEERGQSEAIARN
LREMSTLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKA
STAAEVMGLTAARLKELGLIDNIVPEPLGGAHRNYHEMARNLKHCLVEELNELDTFDKD

KEGG   T30319 (Metagenome): 2556
Entry
2556              CDS       T30319                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1743 (best score: 150.599)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.2556-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2704:3..356
AA seq 117 aa
IAIIIGEGGSGGALALAVANRVWMLENSIYAVLSPEGFASILWKDGSRAMEAAELMKITS
HELLEMGIVDKVISEAGLSSKELLSCVKNELRAELDRLQELPLDQLIEERYQRFRKY

KEGG   T30319 (Metagenome): 6244
Entry
6244              CDS       T30319                                 

Definition
acetyl-coA carboxylase, carboxytransferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Best hit
bhud:A6A11_04745 (best score: 154.066)
Taxonomy
Gammaproteobacteria - Others [GN:bhud]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.6244-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5859:3..284
AA seq 93 aa
VISPEGCASILWKSAEKASTAAEVMGLTATRLKELGLIDNIVPEPLGGAHRNYHEMARNL
KQCLVEELNELDTFDKDGLLERRYERLMSYGYC

KEGG   T30319 (Metagenome): 3495
Entry
3495              CDS       T30319                                 

Definition
acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
mht:D648_2630 (best score: 105.531)
Taxonomy
Gammaproteobacteria - Others [GN:mht]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.3495-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3577:275..571
AA seq 99 aa
MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPAVAPAAIQYAAAPVAPVAAPAAA
PAPAAAAPAEAPAAEVSGHQVRSPMVGTFYRSPSPEAKA

KEGG   T30319 (Metagenome): 9822
Entry
9822              CDS       T30319                                 

Gene name
accB
Definition
acetyl-coA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
spy:SPy_1747 (best score: 98.9821)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.9822-T1-C
LinkDB
Position
C459922:3..305
AA seq 101 aa
SKNEARLVSQVAPQVAPAPVLATPSPVAPTSAPVETVAEEVAALAETSVAAEGDVVESPL
VGVAYLAAGPDKPAFVSVGDNVKKGQTLVIIEAMKVMNEIP

KEGG   T30319 (Metagenome): 2319
Entry
2319              CDS       T30319                                 

Definition
acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Best hit
mht:D648_2630 (best score: 105.531)
Taxonomy
Gammaproteobacteria - Others [GN:mht]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.2319-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2453:220..516
AA seq 99 aa
MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPAVAPAAIQYAAAPVAPVAAPAAA
SAPAAAAPAEAPAAEVSGHQVRSPMVGTFYRSPSPEAKA

KEGG   T30319 (Metagenome): 11351
Entry
11351             CDS       T30319                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
lla:L0189 (best score: 192.971)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.11351-T1-C
LinkDB
Position
C463620:complement(2..325)
AA seq 108 aa
IYPARHIEVQILGDEHGHVIHLGERDCSLQRNNQKVLEESPSIAIGKTLRNEIGSAAVRA
AESVGYENAGTIEFLLDEASGKFYFMEMNTRVQVEHPVTEFVSGVDIV

KEGG   T30319 (Metagenome): 7351
Entry
7351              CDS       T30319                                 

Definition
acetyl-coA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
rhey:FEE42_05910 hin:HI_0972 (best score: 251.136)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.7351-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6497:complement(294..671)
AA seq 125 aa
KQEDIKVKGHAIECRINAEDPKTFLPSPGKVAHLHSPGGLGVRWDSHVYGGYTVPPHYDS
MIAKLITYGDTRDVAIRRMQNALSETIIDGIKTNIPLHELILEDENFQKGGANIHYLEKK
LGMYD

KEGG   T30319 (Metagenome): 12914
Entry
12914             CDS       T30319                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
lla:L0189 (best score: 210.305)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.12914-T1-C
LinkDB
Position
C467471:2..355
AA seq 118 aa
SVGYENAGTIEFLLDEATGKFYFMEMNTRVQVEHPVTEFVSGVDIVKEQIRIASGQPLTL
KQEDIVLKGHAIECRINAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPP

KEGG   T30319 (Metagenome): 3086
Entry
3086              CDS       T30319                                 

Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
rhey:FEE42_05910 rpne:NCTC8284_00969 (best score: 195.667)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.3086-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3222:complement(3..344)
AA seq 114 aa
WRAFSPFFTQVEIVMLEKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLAD
ETVCIGPAPSVKSYLNIPAIIAAAEVTGADAIHPGYGFLSENADFAEQVERSGF

KEGG   T30319 (Metagenome): 194
Entry
194               CDS       T30319                                 

Gene name
accC
Definition
acetyl-coA carboxylase subunit A
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 223.787)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.194-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_263:3..389
AA seq 128 aa
DIVLRGHAIECRINAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSM
IAKIIVHGENRFDALMKMQRALYELDIEGVQTNADFQLDLISDRRVIAGDYDTSFLMETF
LPKYQEKE

KEGG   T30319 (Metagenome): 249
Entry
249               CDS       T30319                                 

Definition
biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 110.923)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.249-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_321:complement(141..341)
AA seq 66 aa
KIIVHGENRFDALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLP
KYQEKE

KEGG   T30319 (Metagenome): 1813
Entry
1813              CDS       T30319                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 198.364)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.1813-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1974:1..372
AA seq 124 aa
SENSKFATMCEEVGIKFIGPSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEAL
IVAEKIGYPVMLKASAGGGGKGIRKVEKPEDLVSAFETASSEAKANYGNGAMYIERVIYP
ARHI

KEGG   T30319 (Metagenome): 17700
Entry
17700             CDS       T30319                                 

Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
aap:NT05HA_0095 (best score: 327.405)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.17700-T1-C
LinkDB
Position
C478623:complement(2..496)
AA seq 165 aa
RGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADTHGNAIYLA
ERDCSMQRRHQKVVEEAPAPGITEEVRRDIGSRCAKACVEIGYRGAGTFEFLYENGEFYF
IEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGLPLSYKQEDIKVK

KEGG   T30319 (Metagenome): 11055
Entry
11055             CDS       T30319                                 

Gene name
accC
Definition
biotin carboxylase, putative
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 (best score: 158.688)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.11055-T1-C
LinkDB
Position
C462940:complement(45..323)
AA seq 92 aa
GGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFDALMKMQRALYELEIDGVMTNSDF
QLDLISDSNVIAGDYDTAFLMEKFLPNYQKNQ

KEGG   T30319 (Metagenome): 5318
Entry
5318              CDS       T30319                                 

Gene name
accC
Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
spy:SPy_1745 lla:L0189 (best score: 329.331)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.5318-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5136:2..565
AA seq 188 aa
GHVVHLGERDCSLQRNNQKVLEESPSIAIGKTLRNEIGAAAVRAAESVGYENAGTIEFLL
DEASGNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQIRIAAGQPLPFKQEDIVLRGHAIEC
RINAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENR
FDALMKMQ

KEGG   T30319 (Metagenome): 17698
Entry
17698             CDS       T30319                                 

Definition
acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Best hit
aap:NT05HA_0095 (best score: 327.405)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.17698-T1-C
LinkDB
Position
C478613:3..497
AA seq 165 aa
RGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADTHGNAIYLA
ERDCSMQRRHQKVVEEAPAPGITEEVRRDIGSRCAKACVEIGYRGAGTFEFLYENGEFYF
IEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGLPLSYKQEDIKVK

KEGG   T30319 (Metagenome): 6200
Entry
6200              CDS       T30319                                 

Gene name
accD
Definition
acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1744 (best score: 258.07)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.6200-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5842:complement(2..466)
AA seq 155 aa
NFIMASMGTVVGEKITRLFEYATVENLPVVLFTASGGARMQEGIMSLMQMAKISAAVQRH
SKAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIENTVRETLPDDFQK
AEFLLEHGFVDAIVKRRELPETIAKLVRLHGGSRG

KEGG   T30319 (Metagenome): 14959
Entry
14959             CDS       T30319                                 

Definition
acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1744 (best score: 55.8398)
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.14959-T1-C
LinkDB
Position
C472353:complement(282..401)
AA seq 39 aa
EDFQKAEFLLEHGFVDAIVKRRELPDMIARLVRLHKGDC

KEGG   T30319 (Metagenome): 5092
Entry
5092              CDS       T30319                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 267.7)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.5092-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4927:complement(2..481)
AA seq 160 aa
EMFTGIETQDPLEFPGYQKKLASMREKTGLDEAVVTGTALIKGEKVALGIMDSNFIMASM
GTVVGEKITRLFEYATAEKLPVVLFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFY
LTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIE

KEGG   T30319 (Metagenome): 195
Entry
195               CDS       T30319                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
lla:L0180 (best score: 200.675)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.195-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_263:425..838
AA seq 138 aa
MALFSKKDKYIRINPNRSVRQKPQAKPEVPDELFSQCPGCKHTIYQKDLGSERICPHCSY
TFRISAQERLDLTIDSGSFVEMFTGIETQDPLNFPGYQKKLATMREKTGLDEAVLTGTAS
IKGQKVALGIMDSNFIMA

KEGG   T30319 (Metagenome): 15064
Entry
15064             CDS       T30319                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI_1260 (best score: 244.202)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.15064-T1-C
LinkDB
Position
C472597:3..404
AA seq 134 aa
QELSADLEPKDILKFKDLKKYKDRITAAQKETGEKDALITMTGTLYNMPIVVAASNFSFM
GGSMGSVVGAKFVKAAEKAMELNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAKMREK
GVPFISVLTDPTLG

KEGG   T30319 (Metagenome): 1096
Entry
1096              CDS       T30319                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
apag:EIA51_06420 paet:NCTC13378_00651 (best score: 103.99)
Taxonomy
Gammaproteobacteria - Others [GN:apag]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.1096-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1225:1..186
AA seq 61 aa
IEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRSTLGNLLSKLTNQPSPFVEVEVVEN
A

KEGG   T30319 (Metagenome): 670
Entry
670               CDS       T30319                                 

Gene name
accD
Definition
acetyl-coA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
ssu:SSU05_1798 (best score: 131.339)
Taxonomy
Firmicutes - Bacilli [GN:ssu]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.670-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_833:85..342
AA seq 86 aa
MALFSKKDKYIRINPNRSLREKPQAKPEVPDELFSKCPGCKHTIYQKDLGSDRICPHCGY
TFRISAQERLALTIDMGSFLEMFTGI

KEGG   T30319 (Metagenome): 10619
Entry
10619             CDS       T30319                                 

Gene name
accD
Definition
acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
spy:SPy_1744 (best score: 103.99)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.10619-T1-C
LinkDB
Position
C461868:complement(117..317)
AA seq 66 aa
DIIIAESQALVGFAGRRVIESTVREQLPDNFQKAEFLQEHGFVDVIVQRSDMRSTIADLL
AFHGGK

KEGG   T30319 (Metagenome): 15038
Entry
15038             CDS       T30319                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
hin:HI_1260 (best score: 238.039)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.15038-T1-C
LinkDB
Position
C472545:3..404
AA seq 134 aa
QELSADLEPKDILKFKDLKKYKDRITAAQKETGEKDALITMTGTLYNMPIVVAASNFSFM
GGSMGSVVGSKFVKAAEKAMELNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAKMREK
GVPFISVLTDPTLG

KEGG   T30319 (Metagenome): 11785
Entry
11785             CDS       T30319                                 

Definition
acetyl-coA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Best hit
pmu:PM0636 (best score: 143.665)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00061  Fatty acid biosynthesis
00620  Pyruvate metabolism
00640  Propanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.11785-T1-C
LinkDB
Position
C464659:93..332
AA seq 80 aa
MSWIDRIFSKGTSSSASRKANVPEGVWTKCTSCEQVLYGEEVKRNLYVCPKCGHHMRIDA
RERLLALLDEGSSQELSADL

KEGG   T30319 (Metagenome): 9658
Entry
9658              CDS       T30319                                 

Gene name
accA
Definition
acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 130.568)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.9658-T1-C
LinkDB
Position
C459538:complement(2..304)
AA seq 101 aa
VPFHRAVLDEPDFAPAAGSDFKVHTRWIETDYKNTISPYSGAPGSVDDDDAERQTVVVEV
NGKRLEVVLPELGGTPAKSSSKPASKTRKSRARGGSNAVSG

KEGG   T30319 (Metagenome): 23363
Entry
23363             CDS       T30319                                 

Definition
acetyl-/propionyl-coenzyme A carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 1091.26)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.23363-T1-C
LinkDB
Position
C490459:3325..5145
AA seq 606 aa
VTQHQAEAAKKFTAVPGRHTGPVSKILIANRGEIAVRVIRAARDEGLQTVAVYADPDRDS
QHVKLADEAYALGGATAAQSYLVMDKLIEIARRSGADAVHPGYGFLSENAQFAQKCIDAG
LTWIGPSPESITQLGDKVAARHIAQKVGAPLVPGTKDPVKSADEVVAFADEHGLPIAVKA
AFGGGGRGIKVARDRESIVEMYESAVREATAAFGRGECFIERFLDSPRHVETQCLADAHG
NVVVVSTRDCSLQRRNQKLVEEAPAPYLSDEQNERLYEASRAILREAGYQGAGTCEFLVG
TDGTISFLEVNTRLQVEHPVSEEISGLDLVREQFRIARGEKIEEKDPVLRGHSFEFRING
EDAGRSFMPAPGTIEKMTVPTGPGVRWDSGFVAGDVIGGNFDSMLAKLIVTGADREQALQ
RARRALAELTIEGMPTVIPFHRVVLDDSAFAPAEGGEFKVHTRWIETEFNNTIPMYSGAP
GSVDSDEDERTTVVVEVNGKRMEVSLPDLGGGAKPAAKPAAKTRKSRSARSAAKGGGDEL
TSPMQGTIVKVAASDGDTVAEGDLILVLEAMKMEQPITAHKAGKVSGLSAKAGDTVTSGA
VLATIK

KEGG   T30319 (Metagenome): 13537
Entry
13537             CDS       T30319                                 

Definition
acetyl-coA carboxylase alpha chain
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Best hit
rmu:RMDY18_15480 (best score: 204.142)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00280  Valine, leucine and isoleucine degradation
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00640  Propanoate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.13537-T1-C
LinkDB
Position
C468941:complement(3..368)
AA seq 122 aa
RASVTHNPAKAIKNFTAVPGHHTGPVSKILIANRGEIAVRIIRAARDEGLETVAVYAEPD
RDAQHVKLADEAYALGGATAPQSYLVMDKLIEVAIRSGADAVHPGYGFLSENAEFAQKVI
DA

DBGET integrated database retrieval system