KEGG   T30319 (Metagenome): 13421
Entry
13421             CDS       T30319                                 

Definition
conserved uncharacterized protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
spy:SPy_0182 (best score: 227.254)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.13421-T1-C
LinkDB
Position
C468641:complement(3..365)
AA seq 121 aa
RIMVIKPGESFEFKDIKVTAVESFDRTCLVTLPVEGAEAQDGELAGLAVTDEEMARKAVN
YVFETPGGTIYHGADSHFSNYFAKHGKDFQIDVAINNYGDNPVGIQDKMTSIDLLRMAEN
L

KEGG   T30319 (Metagenome): 16869
Entry
16869             CDS       T30319                                 

Definition
hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
slg:SLGD_01534 (best score: 245.743)
Taxonomy
Firmicutes - Bacilli [GN:slg]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.16869-T1-C
LinkDB
Position
C476792:complement(3..377)
AA seq 125 aa
MPNVKEITRESWILATFPEWGTWLNEEIEEEVVPEGNFSMWWLGNCGTWIKTPGGANVVM
DLWSNRGKSTKKVKDMVRGHQMANMAGVRKLQPNLRVQPMVIDPFAINELDYYLVSHFHS
DHIDP

KEGG   T30319 (Metagenome): 7649
Entry
7649              CDS       T30319                                 

Definition
hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
spy:SPy_0182 (best score: 664.455)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.7649-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6657:complement(123..1229)
AA seq 368 aa
MEDVIMPNVKEITRESWILATFPEWGTWLNEEIEEEVVPEGNFAMWWLGNCGTWIKTPGG
ANVVMDLWSNRGKSTKKVKDMVRGHQMANMAGVRKLQPNLRVQPMVIDPFAINELDYYLV
SHFHSDHIDPYTAAAILNNPKLEHVKFIGPYHCGLIWEGWGVPKERIIVVKPGDTIELKD
MKIHAVESFDRTCLVTLPVNGADETGGELAGLTVTDEEMAQKAVNYIFETPGGTIYHGAD
SHFSNYFAKHGKDFKIDVALNNYGENPVGIQDKMTSIDLLRMAENLRAKVIIPVHYDIWS
NFMASTNEILELWKMRKDRLQYNFHPFIWEVGGKYTYPQDQHLVEYHHPRGFDDCFEQDS
NIQFKALL

KEGG   T30319 (Metagenome): 935
Entry
935               CDS       T30319                                 

Definition
hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
spy:SPy_0182 (best score: 667.151)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.935-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1046:196..1287
AA seq 363 aa
MPNIKEITRESWILATFPEWGTWLNEEIEEEVVPEGNFAMWWLGNCGTWIKTPGGANVVM
DLWSNRGKSTKKVKDMVRGHQMANMAGVRKLQPNLRVQPMVIDPFAINELDYYLVSHFHS
DHIDPYTAAAILNNPKLEHVKFIGPYHCGRIWEGWGVPKERIIVVKPGDTIELKDMKIHA
VESFDRTCLVTLPVNGADETGGELAGLAVTDEEMAQKAVNYIFETPGGTIYHGADSHFSN
YFAKHGKDFKIDVALNNYGENPVGIQDKMTSIDLLRMAENLRTKVIIPVHYDIWSNFMAS
TNEILELWKMRKDRLQYDFHPFIWEVGGKYTYPQDQHLVEYHHPRGFDDCFEQDSNIQFK
ALL

DBGET integrated database retrieval system