KEGG   T30319 (Metagenome): 13489
Entry
13489             CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
paet:NCTC13378_01706 (best score: 210.305)
Taxonomy
Gammaproteobacteria - Others [GN:paet]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.13489-T1-C
LinkDB
Position
C468801:complement(2..364)
AA seq 121 aa
NQKKENLSAMIKRFKETQASQIMVAPVAADEVSSYGIADCGGIELKGGDSVKINSIVEKP
SVEEAPSNLAVVGRYVFSAAIWDLLEKTPVGVGDEIQLTDAIDMLIEKETVEAFHMTGRS
F

KEGG   T30319 (Metagenome): 10341
Entry
10341             CDS       T30319                                 

Definition
glucose-1-phosphate-uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 spy:SPy_0224 (best score: 187.193)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.10341-T1-C
LinkDB
Position
C461184:2..313
AA seq 104 aa
AYGVIAPQGEGINGLYSVETFVEKPAPEEAPSDLAIIGRYLLTPEIFQILENQKPGAGNE
IQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALK

KEGG   T30319 (Metagenome): 8907
Entry
8907              CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
rmu:RMDY18_05550 (best score: 560.066)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.8907-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7096:complement(12855..13763)
AA seq 302 aa
MATEIKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRPAIQYVVEEAIRAGLNDVLMI
TGRNKRALEDHFDRVPVLEQQLAEQGKDALLASVVATNEMGGDLHYVRQGDPKGLGHAVL
RAKRHVGDEAFAVLLGDDLIDEKEDLLARMVEVQERTGGSVVALMEVPREAISAYGAAAI
EAVEGEDGFVKITGLVEKPAADEAPSNYAVIGRYVLSPKVFEVLEDTAPGRGGEIQLTDA
LQTLAQGEGEGESVYGVVFSGRRFDTGDKLSYLKANVILAAERPEFGDDLRAWLKDFVAE
NC

KEGG   T30319 (Metagenome): 4630
Entry
4630              CDS       T30319                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (fragment)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 (best score: 205.297)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.4630-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4570:3..359
AA seq 119 aa
DHFDSNFELEYNLKEKGKHDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFVGNEPF
VVMLGDDLMDITDDNAIPLTKQLMNDYESTHASTIAVMPVPHEDVSAYGVIAPQGEGSN

KEGG   T30319 (Metagenome): 16332
Entry
16332             CDS       T30319                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
got:AXE85_08115 (best score: 84.7297)
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.16332-T1-C
LinkDB
Position
C475530:321..443
AA seq 41 aa
MKKVRKAIIPAAGYGTRFLPATKALPKEMLPIIDTPTIQYI

KEGG   T30319 (Metagenome): 16071
Entry
16071             CDS       T30319                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
acq:AM609_05960 (best score: 238.424)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.16071-T1-C
LinkDB
Position
C474942:2..436
AA seq 145 aa
QAREALSKTVLIRLNGGLGTSMGLDRAKSLLPVRDGKTFLDLLVDQVLAARRRYGVSLPL
ILMNSFRTREDSLEVLAGHPEIQVDGLPLDFLQNREPKLRADDLTPVEWEADPELEWCPP
GHGDIYTALLASGLLDALLDKGYRY

KEGG   T30319 (Metagenome): 21122
Entry
21122             CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 (best score: 351.288)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.21122-T1-C
LinkDB
Position
C486083:234..848
AA seq 205 aa
MKQKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSD

KEGG   T30319 (Metagenome): 14558
Entry
14558             CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 (best score: 218.779)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.14558-T1-C
LinkDB
Position
C471387:3..389
AA seq 129 aa
DHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAFVGNEPF
VVMLGDDLMDITDDNAVPLTKQLMNDYEETHASTIAVMPVPHEEVSAYGVIAPQGEGKDG
LYSVETFVE

KEGG   T30319 (Metagenome): 16807
Entry
16807             CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
got:AXE85_08115 (best score: 275.404)
Taxonomy
Firmicutes - Bacilli [GN:got]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.16807-T1-C
LinkDB
Position
C476642:complement(1..462)
AA seq 154 aa
FIGDEPFAVLLGDDVVINDEYPAIKQLIDKAEETGCSVIGVQTVPEDQTHRYGVIAPKGQ
DGHLYEVETFVEKPAPGTAPSNQAIMGRYVLNPGIFKHLAKKQVGVGGEVQLTDAIQMLN
EEENVYAYDFQGKRYDVGETIGFVKTTIDFALKS

KEGG   T30319 (Metagenome): 13916
Entry
13916             CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 (best score: 141.354)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.13916-T1-C
LinkDB
Position
C469877:1..246
AA seq 81 aa
IFGILENQTPGAGNEIQLTDAIDTLNKTQRVFAREFKGSRYDVGDKFGFMKTSIEYALKH
PQVKDHLKDYLIDLGKELSGE

KEGG   T30319 (Metagenome): 19816
Entry
19816             CDS       T30319                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
rmu:RMDY18_05550 (best score: 369.392)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.19816-T1-C
LinkDB
Position
C483369:2..649
AA seq 216 aa
EAIRAGLNDVLMITGRNKRALEDHFDRVPVLESQLAEQGKDALLKAVEATNELGELHYVR
QGDPKGLGHAVLRGKVHVGDEPFAVLLGDDLIDEKEDLLSRMVEVQQATGGSVIALMEVP
RESISAYGAAAIEAVEGQDGYVKVTGLVEKPAPEEAPSNFAVIGRYVLSSKVFEVLENTA
PGRGNEIQLTDALQTLAVGTGEGEGVYGVVFKGRRF

KEGG   T30319 (Metagenome): 801
Entry
801               CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
pmu:PM1289 (best score: 519.62)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.801-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_959:complement(3..860)
AA seq 286 aa
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGRPVVGN
EPFAVVLPDVLLADFTANQKKENLSAMIKRFKETKASQIMVAPVSADEVSSYGIADCGGV
ELKGGDSVKINSIVEKPSVDEAPSNLAVVGRYVFSAAIWDLLEKTPVGVGDEIQLTDAID
MLIEKEIVEAFHMTGRSFDCGDKIGYMEAFVEYGLRHDKLGKEFKA

KEGG   T30319 (Metagenome): 7926
Entry
7926              CDS       T30319                                 

Gene name
galU
Definition
galU protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
msu:MS0345 (best score: 268.855)
Taxonomy
Gammaproteobacteria - Others [GN:msu]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.7926-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6781:complement(2..478)
AA seq 159 aa
LINNDRTFVLQKCGHWIFKQKGKSMKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQY
VVNECVAAGIKEIVLVTHSSKNAIENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTI
MHVRQGNAKGLGHAVLCGRPVVGNEPFAVVLPDVLLADF

KEGG   T30319 (Metagenome): 3348
Entry
3348              CDS       T30319                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Best hit
spy:SPy_2202 (best score: 352.829)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00040  Pentose and glucuronate interconversions
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
Other DBs
HMP: SRS016533.3348-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3433:352..966
AA seq 205 aa
MKQKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITNEKAVPLTKQLMDDYERTHASTIAVMLVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSD

DBGET integrated database retrieval system