KEGG   T30319 (Metagenome): 13522
Entry
13522             CDS       T30319                                 

Definition
pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
acq:AM609_11670 (best score: 207.994)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.13522-T1-C
LinkDB
Position
C468907:3..365
AA seq 121 aa
QGEDVVAGIRNTLSLADLERLDKASYDELRSIMRRLETHYRDLCDIEFTIERGKLWMLQT
RVGKRTAAAAFRVATQLVDEKLITMDEALTRVSGEQLTQLMFPQFDDDSSRDLLTRAMAA
S

KEGG   T30319 (Metagenome): 2391
Entry
2391              CDS       T30319                                 

Definition
PEP-utilizing enzyme family protein
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Best hit
stv:V470_05615 (best score: 333.954)
Taxonomy
Firmicutes - Bacilli [GN:stv]
Pathway
00010  Glycolysis / Gluconeogenesis
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.2391-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2526:complement(3..536)
AA seq 178 aa
RNQLALSGEKILEKVYPQLFHHIGMIRGEYLSREINQNILLPSCQEFVKDYLNTICFLYS
DEEVWYRFSELTNTEANCLKGTKEYFDENHPLFGYRGTRRLLACPDEFQAEAHVVTEVYQ
NNPNLSIIFPFVNDAEQLKQAITVLRQQGFTGKIGTMIELPSAYFDLDRILETGISKI

DBGET integrated database retrieval system