KEGG   T30319 (Metagenome): 14274
Entry
14274             CDS       T30319                                 

Gene name
lys
Definition
saccharopine dehydrogenase
  KO
K00290  saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Best hit
spn:SP_0919 (best score: 259.225)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
00310  Lysine degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.14274-T1-C
LinkDB
Position
C470715:3..383
AA seq 127 aa
EDGKWVEVEAMSIKREYDFPQVGQKDMYLLHHEEIESLAKNIPGVKRIRFFMTFGQSYLT
HMKCLENVGLLRTDAINFNGQEIVPIQFLKALLPDPASLGPRTVGKTNIGCIFTGVKDGV
EKTIYIY

KEGG   T30319 (Metagenome): 1662
Entry
1662              CDS       T30319                                 

Gene name
lys
Definition
saccharopine dehydrogenase
  KO
K00290  saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Best hit
spn:SP_0919 (best score: 374.015)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
00310  Lysine degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.1662-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1812:3..533
AA seq 177 aa
SWQWAYQEKFKEAGLTALLGSGFDPGVTSVFSAYALKHYFDEIHYIDILDCNGGDHGYPF
ATNFNPEINLREVSAPGSYWEDGKWVEVEAMSIKREYDFPQVGQKDMYLLHHEEIESLAK
NIPGVKRIRFFMTFGQSYLTHMKCLENVGLLRTDTINFNGQEIVPIQFLKALLPDPA

KEGG   T30319 (Metagenome): 1819
Entry
1819              CDS       T30319                                 

Definition
saccharopine dehydrogenase family protein
  KO
K00290  saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Best hit
spn:SP_0919 (best score: 208.764)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
00310  Lysine degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.1819-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1979:3..314
AA seq 104 aa
KICQDSETFTEIMIASRTKSKCDDLKAKLEGKTSTKIETAALDADKVEEVIALIESYKPE
AVLNVALPYQDLTIMDACLATGVHYIDTANYEAEDTEDPEWRAI

KEGG   T30319 (Metagenome): 13003
Entry
13003             CDS       T30319                                 

Gene name
lys
Definition
saccharopine dehydrogenase
  KO
K00290  saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Best hit
spn:SP_0919 (best score: 66.2402)
Pathway
00300  Lysine biosynthesis
00310  Lysine degradation
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.13003-T1-C
LinkDB
Position
C467667:3..92
AA seq 29 aa
EELDPDPFMEALNEYGLPWVVVENPQMVD

DBGET integrated database retrieval system