KEGG   T30319 (Metagenome): 15290
Entry
15290             CDS       T30319                                 

Definition
enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
hin:HI1734 (best score: 268.47)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.15290-T1-C
LinkDB
Position
C473113:complement(2..409)
AA seq 136 aa
GLASNRSIAYGIAKAMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQ
NCFAELSKRWEKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDISAFSFVAMAQAAR
PYLNPNAALLTLSYLG

KEGG   T30319 (Metagenome): 15260
Entry
15260             CDS       T30319                                 

Definition
enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
hin:HI1734 (best score: 268.47)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.15260-T1-C
LinkDB
Position
C473043:3..410
AA seq 136 aa
GLASNRSIAYGIAKAMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVATDESIQ
NCFAELSKRWEKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDISAFSFVAMAQAAR
PYLNPNAALLTLSYLG

KEGG   T30319 (Metagenome): 4386
Entry
4386              CDS       T30319                                 

Definition
enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
rhey:FEE42_00305 (best score: 224.557)
Taxonomy
Gammaproteobacteria - Others [GN:rhey]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.4386-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4329:3..359
AA seq 118 aa
SYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGVKNFK
KMLAAFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE

KEGG   T30319 (Metagenome): 14877
Entry
14877             CDS       T30319                                 

Definition
enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Best hit
aap:NT05HA_0379 hin:HI1734 (best score: 226.098)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.14877-T1-C
LinkDB
Position
C472165:complement(42..398)
AA seq 118 aa
SYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGVKNFK
KMLATFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE

DBGET integrated database retrieval system