KEGG   T30319 (Metagenome): 15385
Entry
15385             CDS       T30319                                 

Definition
ascorbate-specific PTS system enzyme IIC
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 227.254)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.15385-T1-C
LinkDB
Position
C473339:complement(2..412)
AA seq 137 aa
AYGTAAIGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAGRFGKKEE
SLDNLKLPKFLSIFHDTVVASATLMLVFFGAILLILGPDIMSNKEVITSGTLFNPAKQDF
FMYIIQTAFTFSVYLFV

KEGG   T30319 (Metagenome): 18925
Entry
18925             CDS       T30319                                 

Definition
putative PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 240.736)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.18925-T1-C
LinkDB
Position
C481347:complement(2..490)
AA seq 163 aa
MEVISSVLNWFSSNILQNPAFFVGLLVLIGYALLKKPAHEVFSGFVKATVGYMLLNVGAG
GLVTTFRPILAALNFKFQIGAAVIDPYFGLAAANNKIAAEFPDFVGTATTALLIGFGVNI
LLVAFRKLTKVRTLFITGHIMVQQAATVSLMVLFLVPQLRNAY

KEGG   T30319 (Metagenome): 2128
Entry
2128              CDS       T30319                                 

Definition
PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 289.656)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.2128-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2220:1..522
AA seq 173 aa
AFQGISNKLLPGSFPAVDVAASYGFGSPNAVLSGFAFGLIGQLITIVLLIVFKNPILIIT
GFVPVFFDNAAIAVYADKRGGWKAAVILSFISGVLQVALGALCVALLDLASYGGYHGNID
FEFPWLGFGYIFKYLGIVGYVLVCLFLLVIPQLQFAKAKDKEKYYKGEVQEEA

KEGG   T30319 (Metagenome): 7885
Entry
7885              CDS       T30319                                 

Definition
PTS system, membrane component
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 259.61)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.7885-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6759:3..467
AA seq 155 aa
AYGTAAIGIICGLYWAISSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKIAGRFGKKEE
SLDNIKLPKFLSIFHDTVVASATLMLVFFGAILLILGPEIMSNKEVITSGTLFNPAKQDF
FMYIIQTAFTFSVYLFILMQGVRMFVSELTNAFQG

KEGG   T30319 (Metagenome): 8455
Entry
8455              CDS       T30319                                 

Definition
PTS system, membrane component, putative
  KO
K03475  ascorbate PTS system EIIC component
Best hit
spy:SPy_0174 (best score: 218.009)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.8455-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6980:3..410
AA seq 135 aa
LIGQLITIVLLIVFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVILSFISGVLQVA
LGALCVALLDLAAYGGYHGNIDFEFPWLGFGYIFKYLGIIGYVLVCLFLLVIPQIQFAKA
KDKEKYYNGEVQEEA

DBGET integrated database retrieval system