KEGG   T30319 (Metagenome): 16689
Entry
16689             CDS       T30319                                 

Gene name
ptxA
Definition
phosphotransferase system sugar-specific EII component, putative
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Best hit
spy:SPy_0176 (best score: 147.902)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.16689-T1-C
LinkDB
Position
C476364:complement(150..455)
AA seq 101 aa
MPGMAMPHARPEAGVNRDAFSLITLTEPVTFSDGKEVSVLLSLAATSSKIHTSVAIPQII
ALFELENSIERIKACKSDEEVLALIEESKDSPYLQGLDLDS

KEGG   T30319 (Metagenome): 22720
Entry
22720             CDS       T30319                                 

Definition
putative PTS system, enzyme IIA component
  KO
K02821  ascorbate PTS system EIIA or EIIAB component [EC:2.7.1.194]
Best hit
spy:SPy_0176 (best score: 229.95)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
02060  Phosphotransferase system (PTS)
Other DBs
HMP: SRS016533.22720-T1-C
LinkDB
Position
C489279:complement(1447..1932)
AA seq 161 aa
MNLKQALIENNSIRLGLEAADWKEAVKLAVEPLIESGAILPEYYDAIIESTEEYGPYYIL
MPGMAMPHARPEAGVQRDAFSLITLQKSVVFSDGKEVSVLLALAATSSKIHTSVAIPQII
ALFELEDSIARLQGCQSKEEVLDMIEESKNSPYLEGLDLES

DBGET integrated database retrieval system