KEGG   T30319 (Metagenome): 16765
Entry
16765             CDS       T30319                                 

Definition
raw score 12.67
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Best hit
apl:APL_0486 (best score: 166.007)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
03320  PPAR signaling pathway
Other DBs
HMP: SRS016533.16765-T1-C
LinkDB
Position
C476528:complement(153..458)
AA seq 101 aa
FPFLFRGALDVGATAINEEMKLAASHAIASLAKEPVPLEIIANYGALSFGPDYVIPTPFD
PRLLFTVSSAVAKKAMETGVATRPITDWAAYEKQLKALVSA

KEGG   T30319 (Metagenome): 20870
Entry
20870             CDS       T30319                                 

Gene name
maeB
Definition
NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Best hit
rpne:NCTC8284_03274 hin:HI1245 (best score: 171.014)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
03320  PPAR signaling pathway
Other DBs
HMP: SRS016533.20870-T1-C
LinkDB
Position
C485577:complement(2..301)
AA seq 100 aa
MEYFYMSEQLRQAALDFHEFPIPGKIAVTPTKSLETQHDLALAYSPGVAEPCLEIEKDPS
AASRYTARANLVAVISNGTAVLGLGNIGALASKPVMEGKG

KEGG   T30319 (Metagenome): 7499
Entry
7499              CDS       T30319                                 

Definition
raw score 12.67
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Best hit
apl:APL_0486 (best score: 367.466)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
03320  PPAR signaling pathway
Other DBs
HMP: SRS016533.7499-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6572:complement(2..634)
AA seq 211 aa
MEYIYMSEQLRQAALDFHEFPIPGKIAVTPTKSLETQHDLALAYSPGVAEPCLEIEKDPS
AASRYTARANLVAVISNGTAVLGLGNIGALASKPVMEGKGVLFKKFAGINVFDIEINEHE
PDKLIDIIASLEPTFGGINLEDIKAPECFHIEKALRERMGIPVFHDDQHGTAIIVGAAAL
NGLEIIGKNIADVRLVVNGAGASAIACTNLL

KEGG   T30319 (Metagenome): 8044
Entry
8044              CDS       T30319                                 

Definition
raw score 12.67
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Best hit
apl:APL_0486 (best score: 208.379)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
00620  Pyruvate metabolism
00710  Carbon fixation in photosynthetic organisms
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
03320  PPAR signaling pathway
Other DBs
HMP: SRS016533.8044-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6842:complement(153..518)
AA seq 121 aa
DAIVCTGRSDFPNQVNNVLCFPFLFRGALDVGATAINEEMKLAASHAIASLAKEPVPLEI
IANYGALSFGPDYVIPTPFDPRLLFTVSSAVAKKAMETGVATRPITDWAAYEKQLKALVA
A

DBGET integrated database retrieval system