KEGG   T30319 (Metagenome): 16786
Entry
16786             CDS       T30319                                 

Gene name
fabF
Definition
3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spy:SPy_1748 (best score: 228.409)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.16786-T1-C
LinkDB
Position
C476576:29..460
AA seq 144 aa
MKMKLNRVVVTGYGLTSPIGNTPEEFWNSLKNGKIGIGEITKFDHSAFDVHNAAEINDFP
FDKYFVKKDTNRFDDYSLYALYAAQEAVNNANLDVEALDKDRFGVIVASGIGGIREIEDQ
VLRLHEKGPKRVKPLTLPKALPNM

KEGG   T30319 (Metagenome): 18700
Entry
18700             CDS       T30319                                 

Definition
beta-ketoacyl-acyl-carrier-protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rmu:RMDY18_11700 (best score: 104.76)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.18700-T1-C
LinkDB
Position
C480889:1..186
AA seq 61 aa
TVLAIYNRKAPTTINLENQDPQIDLDVVTQARELPEGEIVGISNSFGFGGHNAVVAFRSV
E

KEGG   T30319 (Metagenome): 16092
Entry
16092             CDS       T30319                                 

Gene name
fabF
Definition
3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
cwo:Cwoe_4158 (best score: 46.9802)
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.16092-T1-C
LinkDB
Position
C474986:318..437
AA seq 40 aa
VSTRVVITGIGAVTPLGVGAETLHERAVAGLSGLNDENEN

KEGG   T30319 (Metagenome): 10713
Entry
10713             CDS       T30319                                 

Definition
beta-ketoacyl-acyl-carrier-protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rmu:RMDY18_11700 (best score: 162.155)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.10713-T1-C
LinkDB
Position
C462088:complement(1..318)
AA seq 106 aa
ARVYAELAGTGVSADAFHITAPDPDALGATRALREALKDGDIDPATVVHINAHATSTPAG
DLPEATAMHATFGEHTKNIAVSATKSMTGHLLGGAGALEAVLTVLA

KEGG   T30319 (Metagenome): 12224
Entry
12224             CDS       T30319                                 

Gene name
fabF2
Definition
3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rmu:RMDY18_11700 (best score: 204.912)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.12224-T1-C
LinkDB
Position
C465753:complement(1..342)
AA seq 114 aa
GGDVPTTWANALKGVSGITKIDEPWVEEYSLPVYIAGRLAEPAHESERLTKVEAKRLDPS
GQLALIAAREAWEDAGFSGSDAESAEEVDPLRTGVAFGTGIGGVWTLLDAWDTL

KEGG   T30319 (Metagenome): 18632
Entry
18632             CDS       T30319                                 

Definition
3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spy:SPy_1748 (best score: 234.187)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.18632-T1-C
LinkDB
Position
C480735:complement(2..427)
AA seq 142 aa
MKLNRVVVTGYGLTSPIGNTPEEFWNSLQTGKIGIGEITKFDHSEFAVHNAAEVQDFPFD
KYFVKKDTNRFDNYSLYALYAAQEAVTNANLDVEAIDKDRFGVIVASGIGGIKEIEDQVI
RLHEKGPKRVKPMTLPKALPNM

KEGG   T30319 (Metagenome): 2893
Entry
2893              CDS       T30319                                 

Gene name
fabF
Definition
3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spy:SPy_1748 (best score: 228.794)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.2893-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3050:complement(3..386)
AA seq 128 aa
ASGNVAMRFGANGVCKSINTACASSNDAIGDAFRSIKFGFQDVMLVGGSEASITPFAIAG
FQALTALSTTEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGN
TCDAYHMT

KEGG   T30319 (Metagenome): 7176
Entry
7176              CDS       T30319                                 

Gene name
fabF
Definition
beta-ketoacyl-acyl-carrier-protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
rmu:RMDY18_11700 (best score: 809.675)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.7176-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6392:225..1496
AA seq 423 aa
MSRKVLVTGLGATTPIGGDVPTTWENATKGVSGVSTLDYPWVKEYDLPVYIAGQLAVPAL
ESGRLTKVEAKRLDPSGQLALIAAREAWEDAGFSGPDAESAEEVDPERTGVAFGTGIGGV
WTLLDAWDTLREKGPRRVLPMTVPMLMPNGNAAAVSMNLKARAAAQTVVSACASSTEAMQ
LGAEMIRSGKADVVIVGGAEAAIHPLPMAAFAKMQALSSRNDDPEKASRPYDVDRDGFVM
GEGAAALILESEEHAKARGARVYAELAGTGVSADSYHITAPDPAALGATRALREALEDGN
INPKTVVHINAHATSTPAGDLPEATAMHETFGEHTKNIAVSATKSMTGHLLGGAGALEAV
LTVLALHHRTAPCTINLDNKDPQIDLDVVTEARELPAGEIVALSNSFGFGGHNAVVAFRS
VED

KEGG   T30319 (Metagenome): 9342
Entry
9342              CDS       T30319                                 

Gene name
fabF
Definition
3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spy:SPy_1748 (best score: 171.014)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.9342-T1-C
LinkDB
Position
C458764:complement(2..298)
AA seq 99 aa
ASGNVAMRFGANGICKSINTACASSNDAIGDAFRSIKFGFQDVMLVGGSESSITPFAIAG
FQALTALSTTEDPTRASIPFDKDRNGFVMGEGSGMLVLE

KEGG   T30319 (Metagenome): 4369
Entry
4369              CDS       T30319                                 

Definition
3-oxoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Best hit
spy:SPy_1748 (best score: 237.654)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.4369-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4312:complement(2..436)
AA seq 145 aa
LVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAMKLALEEAEISPEQV
AYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLGAAGAVEAIATIEAMRHN
YVPMTAGTSELSDYIEANVVYGQGL

DBGET integrated database retrieval system