KEGG   T30319 (Metagenome): 1857
Entry
1857              CDS       T30319                                 

Gene name
fabZ
Definition
hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Best hit
hin:HI_1062 (best score: 170.244)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01212  Fatty acid metabolism
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS016533.1857-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2021:1..303
AA seq 101 aa
LLLFILKVLDVSENQVSKVIEAKEIMTLLPHRYPFLLVDRVLDYKEGEWLKAIKNISVNE
PCFTGHFPGEPILPGVLILEALAQSMGILAFKTHELKGGEL

DBGET integrated database retrieval system