KEGG   T30319 (Metagenome): 19059
Entry
19059             CDS       T30319                                 

Definition
sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01946 (best score: 371.703)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.19059-T1-C
LinkDB
Position
C481667:3..584
AA seq 194 aa
RNMTQHSTPLRFITAGSVDDGKSTLIGRLLYDSKALLTDQIKTLNAGKEKGNKEAIDFSI
LTDGLEAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMVTGASTASAAIVLIDA
SQLNFDEKPLQLLPQTKRHSAILRQLNCPHILVAVNKMDLLDYSEEKFNAIVEAYRQLVA
QLGLKEVHFVPVSA

KEGG   T30319 (Metagenome): 19063
Entry
19063             CDS       T30319                                 

Definition
sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01946 (best score: 370.163)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.19063-T1-C
LinkDB
Position
C481677:3..584
AA seq 194 aa
RNMTQHSTPLRFITAGSVDDGKSTLIGRLLYDSKALLTDQIKTLNAGKEKGNKEAIDFSI
LTDGLEAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMVTGASTASAAIVLIDA
SQLNFNEKPLQLLPQTKRHSAILRQLNCPHILVAVNKMDLLDYSEEKFNAIVEAYRQLAA
QLGLKDVHFVPVSA

KEGG   T30319 (Metagenome): 21686
Entry
21686             CDS       T30319                                 

Gene name
cysN
Definition
putative sulphate adenylate transferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01946 (best score: 454.521)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.21686-T1-C
LinkDB
Position
C487239:2..718
AA seq 238 aa
VSALLGDNLVYVSESTPWYQGEPLLTILENLPSVDEVSHSNADFYFPVQLVVRQDADKAD
DFRGYQGRIERGSVQLGQTIRIEPNGLTAKVTEIITPKGEVTQAVAGEVITLRLDLDIDI
SRGDLFVDESSPLTPQKQLEATICWFDERPLNTARKYLLKHGTQTVFAKISEIESVLNVH
TLEQESGATALKMNDIARVRLSLQKPIVATTYEENIAGGAFILVDEATYNTVAAGMIL

KEGG   T30319 (Metagenome): 21697
Entry
21697             CDS       T30319                                 

Gene name
cysN
Definition
putative sulphate adenylate transferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01946 (best score: 452.21)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.21697-T1-C
LinkDB
Position
C487257:2..718
AA seq 238 aa
VSALLGDNLVYASESTSWYQGEPLLTILENLPSVDEVSHSNADFYFPVQLVVRQDADKAD
DFRGYQGRIERGSVQLGQTIRIEPNGLTAKVTEIITPKGEVTQAVAGEVITLRLDRDIDI
SRGDLFVDESSSLTPQKQLEATICWFDERPLNTARKYLLKHGTQTIFAKISEIESVLNVH
TLEQESGATALKMNDIARVRLSLQKPIVATTYEENIAGGAFILVDEATYNTVAAGMIL

KEGG   T30319 (Metagenome): 11239
Entry
11239             CDS       T30319                                 

Definition
sulfate adenylyltransferase, large subunit/ ATP-sulfurylase, subunit
1 (ATP:sulfate adenylyltransferase)
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Best hit
aos:AXE84_09025 (best score: 211.46)
Taxonomy
Actinobacteria [GN:aos]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.11239-T1-C
LinkDB
Position
C463374:1..324
AA seq 108 aa
AGSVDDGKSTLVGRLLFDSKSVLRDQLAAVEQVSLDRGLTSADLALLTDGLRAEREQGIT
IDVAYRYFATPQRSFILADCPGHVQYTRNTVTGCSTADVVVLLVDARN

KEGG   T30319 (Metagenome): 20613
Entry
20613             CDS       T30319                                 

Gene name
cysD
Definition
sulfate adenylyltransferase, subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01947 (best score: 357.066)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.20613-T1-C
LinkDB
Position
C484999:197..745
AA seq 183 aa
MTKTELNNQHLDWLEAESIHIIREVVAECENPALLFSGGKDSVVLLALARKAFQLGDRPV
HLPFPLVHIDTGHNYPEVIQFRDEQVAKLNARLVIGHVEDSIAKGTVVLRKETDSRNAAQ
AVTLLETIAENGFDALMGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWSLYNAKL
HKG

KEGG   T30319 (Metagenome): 15553
Entry
15553             CDS       T30319                                 

Definition
sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01947 (best score: 181.415)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.15553-T1-C
LinkDB
Position
C473730:complement(109..417)
AA seq 102 aa
ENLELPPIYYSHKREVVRRKGLLVPVTLLTPKLPTEVSEVLDVRFRTVGDISCTCPVAST
ASTPLEIIEETAIADISERSATRLDDQASEAAMEKRKKEGYF

KEGG   T30319 (Metagenome): 1100
Entry
1100              CDS       T30319                                 

Gene name
cysD
Definition
sulfate adenylyltransferase, subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Best hit
hpit:NCTC13334_01947 (best score: 590.497)
Taxonomy
Gammaproteobacteria - Others [GN:hpit]
Pathway
00230  Purine metabolism
00261  Monobactam biosynthesis
00450  Selenocompound metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.1100-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1229:complement(213..1136)
AA seq 307 aa
MTKTELNNQHLDWLEAESIHIIREVVAECETPALLFSGGKDSVVLLALARKAFQLGDRPV
HLPFPLVHIDTSHNYPEVIQFRDEQVAKLNARLVVGHVEDSIAKGTVVLRKETDSRNAAQ
AVTLLETIAENGFDALMGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWSLYNAKL
HKGENMRVFPISNWTELDIWQYIARENLELPPIYYSHKREVVRRKGLLVPVTPLTPKLPN
EVSEVLDVRFRTVGDISCTCPVASTASTPLEIIEETAIADISERSATRLDDQASEAAMEK
RKKEGYF

DBGET integrated database retrieval system