KEGG   T30319 (Metagenome): 22056
Entry
22056             CDS       T30319                                 

Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
rmu:RMDY18_13080 (best score: 642.884)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.22056-T1-C
LinkDB
Position
C487985:complement(135..1196)
AA seq 353 aa
ELTGGIEPARTRILRALKAGKSVVSGNKALLAKHGVELQAAADESGAQLSYEAAVAGAIP
ILRPLRDSLAGDRVTRVLGIMNGTTNYILDQMDTTGASFADALAEAQKLGYAEADPTADV
EGHDAASKAAIVASLAFHSTFTIDDVHTEGITSITADDVAAADADGYVIKLLAICEREGE
NGANIRVNPTLIPRQHPLAGVHGAFNAVFVEAENAGELMFYGPGAGGAPTASAVLGDFVS
LARRLVLGGPGVPETSHAQLHATGLDNVVSRYSVGVLVEDRLGVLANITRILTEHGISVD
SLRQSTPKEGAAQIRMVTHSAKDADLRRAIAVIDALDTVREVNSVIRVESEKH

KEGG   T30319 (Metagenome): 10349
Entry
10349             CDS       T30319                                 

Gene name
hom
Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
rmu:RMDY18_13080 (best score: 189.889)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.10349-T1-C
LinkDB
Position
C461202:complement(3..311)
AA seq 103 aa
VSGNKALLAKHGVELQAAADKSGAQLSYEAAVAGAIPILRPLRDSLAGDTVTRVLGIMNG
TTNYILDQMDTTGATFADALKDAQELGYAEADPTADVEGHDAA

KEGG   T30319 (Metagenome): 22478
Entry
22478             CDS       T30319                                 

Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
rmu:RMDY18_13080 (best score: 157.147)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.22478-T1-C
LinkDB
Position
C488817:complement(3..251)
AA seq 83 aa
VAEKIKVALLGAGNVGSQAARILVEDNAVLEKRIGAPVELIGIAVRDTNASRHWNADPSL
YTTDAESLIDAADVVIELTGGIE

KEGG   T30319 (Metagenome): 17853
Entry
17853             CDS       T30319                                 

Definition
hypothetical protein
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
got:AXE85_01720 (best score: 47.7506)
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.17853-T1-C
LinkDB
Position
C478969:425..508
AA seq 28 aa
MKIAILGYGTVGSGVYEIITNGNTEELK

KEGG   T30319 (Metagenome): 14511
Entry
14511             CDS       T30319                                 

Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
spn:SP_1361 (best score: 238.039)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.14511-T1-C
LinkDB
Position
C471257:3..389
AA seq 129 aa
AKTFITRALEAGKHVVTANKDLLAVHGAELLEVAKAHNVALYYEAAVAGGIPILRTLVNS
LASDKITRVLGVVNGTSNFMMTKMVTEGWSYEDALAEAQRLGFAESDPTNDVDGIDAAYK
MVILSQFAF

KEGG   T30319 (Metagenome): 4534
Entry
4534              CDS       T30319                                 

Gene name
hom
Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
spn:SP_1361 (best score: 120.938)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4534-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4480:195..395
AA seq 67 aa
VPFLLKENGEKIVQSAHSEIEVAKVLVKDEDEKNRLLAAGNDFNFVTNVDDILADKDITI
VVELMGR

KEGG   T30319 (Metagenome): 10316
Entry
10316             CDS       T30319                                 

Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
spn:SP_1361 (best score: 183.341)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.10316-T1-C
LinkDB
Position
C461116:3..311
AA seq 103 aa
RTLVNSLAADKVTRVLGVVNGTSNFMMTKMVEEGWSYEDALAKAQELGYAESDPTNDVDG
IDAAYKMVILSQFAFGMNVQFDQVGHKGIRNITPEDVAVAQSL

KEGG   T30319 (Metagenome): 6545
Entry
6545              CDS       T30319                                 

Definition
homoserine dehydrogenase (HDH)
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
spn:SP_1361 (best score: 192.971)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.6545-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6064:3..311
AA seq 103 aa
MTVKIALLGFGTVASGVPFLLKENGEKINQSAHSEIEVAKVLVKDEDEKNRLLTAGNDFN
FVTNVDDILSDQDITIVVELMGRIEPAKTFITRALEAGKHVVT

KEGG   T30319 (Metagenome): 18807
Entry
18807             CDS       T30319                                 

Definition
homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Best hit
spn:SP_1361 (best score: 139.813)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.18807-T1-C
LinkDB
Position
C481089:304..564
AA seq 87 aa
MSVKIALLGFGTVASGVPFLLKENKEKIVQAAQSEIEVAKVLVKDDQEKARLLEAGNDFN
FVTNIDEILSDKDITIVVELMGRIEPA

KEGG   T30319 (Metagenome): 11217
Entry
11217             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 190.274)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.11217-T1-C
LinkDB
Position
C463318:complement(3..323)
AA seq 107 aa
LSEVTALAREKGFTEPDPRDDLSGQDVARKLLILAREAGLELELSDVEVEGVLPKGFSEG
KSADEFMAMLPQLDAEFKARVEAAKAEGKVLRYVGQIKDGHCKVSII

KEGG   T30319 (Metagenome): 7362
Entry
7362              CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 540.421)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.7362-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6501:3..893
AA seq 297 aa
THFNEAIEIFYNIINGLHAENNKFDLAGTKALIDAEFAQIKGLLEEIRQAGKVEDKVKAT
IDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAQGGYLESSVDIDESTKRVDAKSIGK
DKVVLMAGFTACNDKGELVLLGRNGSDYSAACLAACLDASVCEIWTDVDGVYTCDPRLVP
DARLLPSLSYREAMELSYFGAKVIHPRTIGPLLPKQIPCVIKNTGNSSAPGSIIDGHVKS
EGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKAGISVILITQSSSEYSI

KEGG   T30319 (Metagenome): 20362
Entry
20362             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
rpne:NCTC8284_03341 (best score: 296.975)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.20362-T1-C
LinkDB
Position
C484477:3..494
AA seq 163 aa
LSEVTALAREKGFTEPDPRDDLSGQDVARKLLILAREAGLELELSDVEVEGVLPKGFSEG
KSADEFMAMLPQLDAEFKARVEAAKAEGNVLRYVGQIKDGHCKVSIIAVDQNNPLYKVKD
GENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRTLHH

KEGG   T30319 (Metagenome): 7363
Entry
7363              CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 573.933)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.7363-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6502:3..959
AA seq 319 aa
THFNEAIEIFYNIINGLHAENNKFDLAGTKALIDAEFAQIKGLLEEIRQAGKVEDKVKAT
IDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAQGGYLESSVDIEESTKRVDAKSIGK
DKVVLMAGFTACNDKGELVLLGRNGSDYSAACLAACLDASVCEIWTDVDGVYTCDPRLVP
DARLLPSLSYREAMELSYFGAKVIHPRTIGPLLPKQIPCVIKNTGNSSAPGSIIDGHVKS
EGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKAGISVILITQSSSEYSISFC
VPVKSADAAKAILEQEFAT

KEGG   T30319 (Metagenome): 15422
Entry
15422             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
rpne:NCTC8284_03341 (best score: 126.331)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15422-T1-C
LinkDB
Position
C473433:complement(221..412)
AA seq 63 aa
HCKVSIIAVDQNNPLYKVKDGENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRT
LHH

DBGET integrated database retrieval system