KEGG   T30319 (Metagenome): 227
Entry
227               CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Best hit
siv:SSIL_1698 (best score: 56.9954)
Pathway
00670  One carbon pool by folate
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.227-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_292:complement(289..396)
AA seq 35 aa
LASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK

KEGG   T30319 (Metagenome): 21777
Entry
21777             CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
siv:SSIL_1698 (best score: 69.707)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.21777-T1-C
LinkDB
Position
C487409:3..143
AA seq 46 aa
CGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLNKD

KEGG   T30319 (Metagenome): 11955
Entry
11955             CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
apag:EIA51_09595 pmu:PM1933 (best score: 150.599)
Taxonomy
Gammaproteobacteria - Others [GN:apag]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.11955-T1-C
LinkDB
Position
C465057:2..271
AA seq 89 aa
EHHIRQADVLVVAVGKPRFIPGDWIKEGATVIDVGINRINGKLVGDVEYDVAIQKAAYIT
PVPGGVGPMTVAMLMFNTLYAYEHNNQLV

KEGG   T30319 (Metagenome): 15134
Entry
15134             CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
hso:HS_1221 (best score: 114.39)
Taxonomy
Gammaproteobacteria - Others [GN:hso]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.15134-T1-C
LinkDB
Position
C472755:complement(2..208)
AA seq 69 aa
MTAQIISGTELSKKIKSDVANKIEHYRAQGKRAPGLAVILVGADPASQVYVGSKRKSCEE
IGMVSKSYD

KEGG   T30319 (Metagenome): 4068
Entry
4068              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
spy:SPy_1502 (best score: 98.9821)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.4068-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4057:242..514
AA seq 91 aa
MAQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA
GFRSEVVRVPEAITQAELLDLIAKYNQDPAW

KEGG   T30319 (Metagenome): 1588
Entry
1588              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
lla:L76582 (best score: 194.126)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.1588-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1704:complement(2..364)
AA seq 121 aa
LVVILVGDNPASQVYVRNKERSALAAGFRSEVVRVPDTITQEELLDLIAKYNQDSAWHGI
LVQLPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGI
D

KEGG   T30319 (Metagenome): 7257
Entry
7257              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
hin:HI0609 (best score: 247.284)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.7257-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6440:complement(2..409)
AA seq 136 aa
GMVSKSYDLPETTTEAELLQLIDQLNADETIDGILVQLPLPEQINSTSVIERISPEKDVD
GFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIDLHGKHAVIVGASNIVGRPMSLELLL
AGATVTVTHRFTKDLE

KEGG   T30319 (Metagenome): 9941
Entry
9941              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
lla:L76582 (best score: 135.191)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.9941-T1-C
LinkDB
Position
C460210:2..307
AA seq 102 aa
QGQLAEKTERLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAAGFRSEVVRVPETIT
QEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPE

KEGG   T30319 (Metagenome): 21771
Entry
21771             CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
siv:SSIL_1698 (best score: 69.707)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.21771-T1-C
LinkDB
Position
C487399:3..143
AA seq 46 aa
CGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLNKD

KEGG   T30319 (Metagenome): 8855
Entry
8855              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
rmu:RMDY18_16570 (best score: 587.03)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.8855-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7090:complement(7976..8869)
AA seq 297 aa
MEGKIMPQILDGNATAAAIKEELKERVEALKAKGITPGLGTVLVGDDPASRSYVGAKHRD
CAEIGINSIRVDLPGDITQEELDAEIDKLNNDPACTSYIVQLPLPKHLDTNRVLERIAPE
KDADGLHPTNLGKLVLNVSEPLDSPLPCTPNGVIELVKRHGIDWNGKNVVVLGRGITVGR
PLGLLLTRREVNATATLAHTGTENLDEVLREADVIVAAVGVPHVLKAHQVKDGAILLDVG
VSRAEDPETGKKKLFGDVSPEAAQKASWVSPNPGGVGPMTRAELLVNVVETAERQAA

KEGG   T30319 (Metagenome): 2857
Entry
2857              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
ccel:CCDG5_0608 (best score: 149.828)
Taxonomy
Firmicutes - Clostridia [GN:ccel]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.2857-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3022:1..312
AA seq 104 aa
MFHEYGIDLEGKNAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHNLAKVAAKADILVV
AIGRAKFVTADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPL

KEGG   T30319 (Metagenome): 15172
Entry
15172             CDS       T30319                                 

Definition
tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
lla:L76582 (best score: 197.978)
Taxonomy
Firmicutes - Bacilli [GN:lla]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.15172-T1-C
LinkDB
Position
C472837:complement(2..406)
AA seq 135 aa
KDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIELEGKNAVVIGRSNIVGKPMAQ
LLLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTDDFVKPGAVVIDVGMNRDEN
GKLCGDVDYEAVAPL

KEGG   T30319 (Metagenome): 7389
Entry
7389              CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Best hit
pmu:PM1933 (best score: 478.404)
Taxonomy
Gammaproteobacteria - Others [GN:pmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.7389-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6522:complement(32..889)
AA seq 285 aa
MTAQIISGTELSKKIKSDVANKIEHYRAQGQRAPGLAVILVGADPASQVYVGSKRKSCEE
IGMISRSYDLPETTTEAELLQLIDILNADETIDGILVQLPLPEQINSSLVIERISPEKDV
DGFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIDLHGKHAVIVGASNIVGRPMSLELL
LAGATVTVTHRFTKDLEHHIRQADILVVAVGKPRFIPGDWIKAEATVIDVGINRINGKLV
GDVEYDVARQKAAYITPVPGGVGPMTVAMLMFNTLYAYEHNNQLV

KEGG   T30319 (Metagenome): 4950
Entry
4950              CDS       T30319                                 

Gene name
fchA
Definition
methenyltetrahydrofolate cyclohydrolase
  KO
K01500  methenyltetrahydrofolate cyclohydrolase [EC:3.5.4.9]
Best hit
vte:BHY08_07570 (best score: 75.485)
Pathway
00670  One carbon pool by folate
01100  Metabolic pathways
Other DBs
HMP: SRS016533.4950-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4808:complement(119..349)
AA seq 76 aa
PGGGSAAALSAANGISLTKMVCELTIGKKKYAEFEDHIKGVHEKSAHLQDQLLEAIDXQR
KRKKRKSLVVKPCKKL

DBGET integrated database retrieval system