KEGG   T30319 (Metagenome): 23226
Entry
23226             CDS       T30319                                 

Definition
uncharacterized protein HI_1552
  KO
K09789  pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85]
Best hit
hin:HI_1552 (best score: 399.053)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS016533.23226-T1-C
LinkDB
Position
C490315:2626..3273
AA seq 215 aa
VKTKFYDHQGEHLIVYFAGWGTPLDVVAHLILPTNNNLLICYDYQDLKLDFDFSAYQQIR
VVAWSMGVWVAERVLQGITLQSATAVNGTGLPCDDSFGIPYAIFKGTLENLTENTRSKFE
RRICGDKVSFEGYQQFSARPFSEIHQELTTLFAMIQQDKRTDLIHWINAWVSSRDKIFMP
ANQHQYWASRCAVQEIEGEHYVFSRFTHWSALWSH

DBGET integrated database retrieval system