KEGG   T30319 (Metagenome): 23227
Entry
23227             CDS       T30319                                 

Gene name
bioC
Definition
biotin biosynthesis protein bioC
  KO
K02169  malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Best hit
hin:HI_1551 (best score: 424.861)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
01240  Biosynthesis of cofactors
Other DBs
HMP: SRS016533.23227-T1-C
LinkDB
Position
C490315:3261..4040
AA seq 259 aa
MESLTSVDKSRIQHAFQKALNSYDEHALIQQKMNIKLMMHLQDYLPNGSLDSVLELCCGS
GMLSSLLQKQISANYWLFNDLCDVRALLIEKLIQPFDFSCGDAENFPFPRRFDLIASASA
VQWFHHPVNFISHCKTGLKPNGLLAITSFGEDNLKEIRQMTNMGLSYPNLSQWQNWLAND
FELLWHDDVNVILDFDTPLDVLKHLKYTGVTATNQKNWTRKNLNKFIDDYLQAFSLPSGK
VRLTYHPLFFIARYSRAGN

DBGET integrated database retrieval system