KEGG   T30319 (Metagenome): 23420
Entry
23420             CDS       T30319                                 

Definition
biotin-(acetyl-coA carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
rmu:RMDY18_15340 (best score: 449.129)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.23420-T1-C
LinkDB
Position
C490531:1..720
AA seq 239 aa
GRLARAWTAPPGACLAASIVVRPHASADPLARELPEDSYHWMTLTAGLSVVDIWRSYGVD
AALKWPNDVIAQGAKGCGILAQLVPESGANEGQRSIIVGIGQNTNMSAEQLPVPTATSLS
LCTGTVIDSSEVLTRLLGIFARRYRAFVRAGGDPERPDPLTPDSLSLLDQARAATATLGA
SVRMSLPDGSTVEGTAEDLDAQGRILIRREDGALEPYAVGDIEHLRPANGSYGDFQQAH

KEGG   T30319 (Metagenome): 20204
Entry
20204             CDS       T30319                                 

Definition
biotin-(acetyl-CoA-carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
rmu:RMDY18_15340 (best score: 192.971)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.20204-T1-C
LinkDB
Position
C484167:147..692
AA seq 182 aa
MMVHMSLPDQRPAILDPSRILPEAREAGYSFVRVYDVVDTTNTEIVRRLTRGEPCERTEL
GELSVFTTLYMTAGKGRMDRSWTAPAGTCLATSIVVRPHAGIGQQLPITSYHWLTMLAGL
SVLDVWRELGLDAALKWPNDLVIQGRKACGILALLLSEPAQAPGEKERLSIVVGIGQNLN
MR

KEGG   T30319 (Metagenome): 3829
Entry
3829              CDS       T30319                                 

Gene name
birA
Definition
bifunctional protein birA
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
hin:HI0220.1 (best score: 353.599)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.3829-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3850:244..1071
AA seq 276 aa
MSFLKLDSDELVQEIALLREVGLNIQEENNVCQLVPEMPLLNPQTISTALLPYSVHYHRT
ISSTNEFITNHINQLKKGDLCLAEYQTAGRGRRGRQWLSPFAGQLIFSFYWTIDPKKALD
GLSLVIGLAIAEALNAKVKWPNDVLLSGRKLGGILVEIINNKNGLLNLVVGIGINVKLPQ
STEISQPYAQLTEQDPDIDRETILIKVIQRIYSRLAQFEEKGIDEEFMQQWINHNEFLGD
EVNVFTERGAISGIEQGIDKRGYLKVITDEGERYFN

KEGG   T30319 (Metagenome): 15278
Entry
15278             CDS       T30319                                 

Definition
biotin-(acetyl-CoA-carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
spy:SPy_1362 (best score: 109.383)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.15278-T1-C
LinkDB
Position
C473083:complement(1..354)
AA seq 118 aa
MKSYQEVYKILAHETDYLSGEKIAEILNLSRTSVWKAIQRLQQEGLEIDSIKNRGYKLLH
GDLILPQEIEANSPISVQFKPITRSTQSDAKEAMEAGAKGDTLYLSTGQTMGRGRFQR

KEGG   T30319 (Metagenome): 21999
Entry
21999             CDS       T30319                                 

Gene name
birA
Definition
biotin--[acetyl-coA-carboxylase] ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
spy:SPy_1362 (best score: 251.906)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.21999-T1-C
LinkDB
Position
C487885:complement(2..637)
AA seq 212 aa
MKSHQLVYQILARENDYVSGEKIGEELNLSRTSIWKAIQRLQQEGLEIDSIKNRGYKLIQ
GDLILPDLIQENTNLTIRYKPETKSTQTDAKEGIEAGNQGNTLYLSTCQTAGRGRFQRPY
YSPSQGGIYMSLHIQPNLPYEKLPSYTLLVAAAVCKAIKNLTMIEVDIKWVNDIYFKNKK
IAGILTEAMTSVETGLVTDVIIGLGINFSIAD

KEGG   T30319 (Metagenome): 21130
Entry
21130             CDS       T30319                                 

Definition
biotin-(acetyl-CoA-carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
rmu:RMDY18_15340 (best score: 150.599)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.21130-T1-C
LinkDB
Position
C486103:complement(387..848)
AA seq 153 aa
NMREDQVPVPTATSALIQRGEPVDNHVVLNRMLTIFARRYREFVSVGGDPQKTLLCGQSL
LDQARAATVTLGAEVSVHLPDGRIVTGVATDLDAQGRILIRDTTGAVQAYSVGDIEHLRP
ADGSYGNFYPALRQEDSPTLAPSEITPNTSAKA

KEGG   T30319 (Metagenome): 21149
Entry
21149             CDS       T30319                                 

Gene name
birA
Definition
biotin--[acetyl-coA-carboxylase] ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
spy:SPy_1362 (best score: 250.366)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.21149-T1-C
LinkDB
Position
C486161:complement(2..637)
AA seq 212 aa
MKSHQLVYQILARENDYVSGEKIGEELNLSRTSIWKAIQRLQQEGLEIDSIKNRGYKLIQ
GDLILPDLIQEKTDLTIRYKPDTKSTQTDAKEGIEAGNKGNTLYLSTCQTAGRGRFQRPY
YSPSQGGIYMSLHIQPNLPYEKLPSYTLLVAAAVYKAIKNLTMIEVDIKWVNDIYFKNKK
IAGILTEAMTSVETGLVTDVIIGLGINFSIAD

KEGG   T30319 (Metagenome): 3595
Entry
3595              CDS       T30319                                 

Definition
biotin-(acetyl-CoA-carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Best hit
spy:SPy_1362 (best score: 157.147)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00780  Biotin metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS016533.3595-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3662:complement(2..412)
AA seq 137 aa
TDYISGEKIAEELSLTRTSIWKAIKRLEQEGIEIDSIKNKGYKLVNGDLILPELLEQNLP
IKISFKPETRSTQLDAKEAIDLGNEANTLYLASYQTAGRGRFQRSFYSPQGGIYMTLHLK
PNLPYDKLPSYTLLVAG

DBGET integrated database retrieval system