KEGG   T30319 (Metagenome): 3940
Entry
3940              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 201.445)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.3940-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3948:complement(2..331)
AA seq 110 aa
TAQVGESKPEKLTLTYDLKQAMRYGENPQQDADFYQKALPTDYSIASAKQLNGKELSFNN
IRDADAAICIIRDFKDHPTVVALKHMNPCGIGQADDIETAWDYAYESDPV

KEGG   T30319 (Metagenome): 2037
Entry
2037              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 202.986)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.2037-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2148:3..335
AA seq 111 aa
FAQELKKLGWDIISTGGTKVALDSAGVDTIAIDDVTGFPEMMDGRVKTLHPNIHGGLLAR
RDLDSHLEAAKDNNIELIDLVVVNLYPFKETILKPDVTYADAVENIDIGGP

KEGG   T30319 (Metagenome): 13091
Entry
13091             CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 202.601)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.13091-T1-C
LinkDB
Position
C467883:complement(2..358)
AA seq 119 aa
GLLARRDLDSHLEAAKDNKIELIDLVVVNLYPFKETILKPDVTYADAVENIDIGGPSMLR
SAAKNHASVTVVVDPADYDVVLDELAANGETSYEARQRLAAKVFRHTAAYDALIAEYFT

KEGG   T30319 (Metagenome): 8858
Entry
8858              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
rmu:RMDY18_16610 (best score: 124.02)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.8858-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7090:complement(11434..11619)
AA seq 61 aa
RGAVAASDAFFPFADGLQVLLDAGVRAVVHPGGSIRDEEVIEAAKAAGVTMYLTGTRHFF
H

KEGG   T30319 (Metagenome): 2281
Entry
2281              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 191.43)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.2281-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2407:complement(2..307)
AA seq 102 aa
LAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQAMRYGENPQQDADFYQKALP
TDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVA

KEGG   T30319 (Metagenome): 1679
Entry
1679              CDS       T30319                                 

Gene name
purH
Definition
phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
hin:HI0887 (best score: 1014.99)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.1679-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1829:1669..3267
AA seq 532 aa
MTDRPIRQALLSVSDKAGIVEFAQGLVQRGIKLLSTGGTAKLLEQHGLPVTEVSDYTGFP
EMMDGRVKTLHPKVHGGILGRRGTDDAIMQQHGIEGIDMVVVNLYPFAATVAKPDCTLAD
AVENIDIGGPTMVRSAAKNHKDVAIVVNNGDFNAILAEMDKHQNSLTLETRFDLAIKAFE
HTAQYDSMIANYFGRMVKPYHVAEEEDANAKCGQFPRTLNLNFVRKQTMRYGENAHQNAA
FYVDLNLKEASVATAHQLQGKALSYNNIADTDAALECVKEFDEPACVIVKHANPCGVALG
KDILDAYNRAYQTDPTSAFGGIIAFNRELDEKTANEIVERQFVEVIIAPKVSAEAQEVVK
RKKNVRLLECGEWTSRSERLDFKRVNGGLLVQDADLGMVGVDDLKVVSKRQPTEQELKDL
LFCWKVAKFVKSNAIVYAKDNQTIGIGAGQMSRVYSAKIAGIKTQDEGLTVAGCVMASDA
FFPFRDSIDAAAKVGIQCVIHPGGSMRDKEVINAADEHNMVMVLTGMRHFRH

KEGG   T30319 (Metagenome): 2747
Entry
2747              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 191.815)
Taxonomy
Firmicutes - Bacilli [GN:spz]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.2747-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2886:complement(2..337)
AA seq 112 aa
DGRVKTLHPNIHGGLLARRDLDSHLEAAKNNKIELIDLVVVNLYPFKETILKPDVTYADA
VENIDIGGPSMLRSAAKNHASVTVVVDPADYAIVLEELSANSETTYETRQRL

KEGG   T30319 (Metagenome): 8105
Entry
8105              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 spyo:STAB901_00300 (best score: 78.1814)
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.8105-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6871:1750..1887
AA seq 45 aa
VEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH

KEGG   T30319 (Metagenome): 18967
Entry
18967             CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
aap:NT05HA_1329 (best score: 316.235)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.18967-T1-C
LinkDB
Position
C481451:complement(2..511)
AA seq 170 aa
MTDRPIRQALLSVSDKTGIVEFAQGLVQRGVKLLSTGGTAKLLEQHGLPVTEVSDYTGFP
EMMDGRVKTLHPKVHGGILGRRGTDDAIMQQHGIEGIDMVVVNLYPFAATVAKPNCTLED
AVENIDIGGPTMVRSAAKNHKDVAIVVNNHDFNNILAEMDKHHNSLTLET

KEGG   T30319 (Metagenome): 5816
Entry
5816              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
rmu:RMDY18_16610 (best score: 891.338)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.5816-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5538:3..1418
AA seq 472 aa
LRRALISVYDKTGLEEFARGLHEAGVALVSTGSTASTIAAAGVPVTEVTEVTGFPECLEG
RVKTLHPRIHAGILADRRKQEHIDTLDELDVEAFDLVVVNLYPFVETVASGADQDAIIEK
IDIGGPSMVRAAAKNHDAVAIVVDPADYARTVEAAKNGGFSLDERRRLAAGAFAHTAAYD
TAVATWTASQFLQDEDANFWPPYAGLGFERSETLRYGENPHQRAALYVDPAAAPGIAQAE
QVHGKAMSYNNYVDADAALRAAYDFDEPAVAVIKHNNPCGIAVATPGAADPIADAHAKAH
ACDPLSAYGGVIAANRPVTAAMAQTVKGIFTEVIVAPGFEPEALEILREKKNLRLLVLPE
NFAREAIEYRPISGGALFQEADRLQAEGDDPKNWALVAGEVADEATLRDLEFAWRALRSP
KSNAILLADNGAAVGIGMGQVNRVDSCKLSVERANTLGGEGNERARGAVAAS

KEGG   T30319 (Metagenome): 10340
Entry
10340             CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
blo:BL0735 (best score: 55.4546)
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.10340-T1-C
LinkDB
Position
C461180:3..89
AA seq 28 aa
SIRDDEVIQAAKDAGVTMYLTGTRHFFH

KEGG   T30319 (Metagenome): 2443
Entry
2443              CDS       T30319                                 

Gene name
purH
Definition
bifunctional purine biosynthesis protein purH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Best hit
spz:M5005_Spy0027 (best score: 56.225)
Pathway
00230  Purine metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01523  Antifolate resistance
Other DBs
HMP: SRS016533.2443-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2575:296..469
AA seq 57 aa
LPKNLKKLGWDIISTGGTKVALDNTGVSTIAIDDSYDIFDSKLESVIVEDGFKRRYL

DBGET integrated database retrieval system