KEGG   T30319 (Metagenome): 4398
Entry
4398              CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 406.371)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4398-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4339:3..617
AA seq 205 aa
AAMVSELGLKPAVLEKISKSIRALATLPIEENEFLYDTFLAAGENNNAKLIAAYFNQNGI
DARYVHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIPGFFGVTKENQICTFSR
GGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPELTYREMRELAYAGFSV
LHDEALLPAYRGKIPLVIKNTNNPD

KEGG   T30319 (Metagenome): 10321
Entry
10321             CDS       T30319                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 199.904)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.10321-T1-C
LinkDB
Position
C461130:3..311
AA seq 103 aa
NNPDHPGTRIVLEHSSDKFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEDLNIG
WEHMPTGIDDLSIILRSRELTPIKEEEILRQLVQKAEVDHAEI

KEGG   T30319 (Metagenome): 4948
Entry
4948              CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 513.842)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4948-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4807:176..1063
AA seq 296 aa
MSHLSVAKFGGTSVANYSAMQACAKIVIADPNTRVVVLSASAGVTNLLVALANGVEAEER
AKLIGEVRQIQENILNELKDDSRVRPVIEKYLENITALSEAASLATSLALTDELISHGEM
ISTQIFIEVLRELQTSATWVDVRTLVATNDNFGKAAPDDSQTQANCDNLLKPLIDRGELV
ITQGFIGREPSGKTTTLGRGGSDYSAALLAEVLNAKDVLIWTDVAGIYTTDPRVVPNAQR
IDTMSFAEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQP

KEGG   T30319 (Metagenome): 8337
Entry
8337              CDS       T30319                                 

Definition
aspartokinase III
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rpne:NCTC8284_02577 (best score: 261.922)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.8337-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6947:1..489
AA seq 162 aa
WVTRDPQPRPTFRAIALRRDQTLLTLSSLSMLHAQGFLANVFTILAKYKISVDTITTSEV
SIALTLDKTGSASSGVELLSPELLEELSQYCTVKVDTGLSLVALIGNDLHLASGVAKRIF
DTLEGYNIRMISYGASTNNICMLAMSDKADDVVRSLHKSLFE

KEGG   T30319 (Metagenome): 14687
Entry
14687             CDS       T30319                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 146.362)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.14687-T1-C
LinkDB
Position
C471707:161..394
AA seq 78 aa
MKVVKFGGSSLASAGQLEKVLNIVKSDKERRFVVVSAPGKRNAEDTKVTDALIKYYRDYV
AGNDISASQSWIIDRYAA

KEGG   T30319 (Metagenome): 21185
Entry
21185             CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 233.032)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.21185-T1-C
LinkDB
Position
C486241:2..412
AA seq 136 aa
LNEAKINIDMIVQNVSTDRPNVTDISFTLNQAQGPQALQVLEKTQAEIGFEEVIYNEAVG
KLSLVGAGMKTNPGVSFTFFEALSNAGVNVEMISTSEIRISVITELSKLDEAVRAVHTAF
ELDAEGEATVYGGTGR

KEGG   T30319 (Metagenome): 4590
Entry
4590              CDS       T30319                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 119.398)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4590-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4528:complement(143..334)
AA seq 63 aa
EKMKSHIGVTATATRALSENKINIQMMSQGSSEVSIMFVVNKEQEKAAIKALYHAFFGES
KED

KEGG   T30319 (Metagenome): 21912
Entry
21912             CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 590.882)
Taxonomy
Gammaproteobacteria - Others [GN:hik]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.21912-T1-C
LinkDB
Position
C487685:complement(35..1108)
AA seq 357 aa
NITALSEAASLATSFALTDELISHGEMMSTQIFIEVLRELQASATWVDVRTLVATNDNFG
KAAPDDAQTQANCNNLLKPLIDRGELVITQGFIGREPGGKTTTLGRGGSDYSAALLAEVL
NAKDVLIWTDVAGIYTTDPRIVPNAQRIDTMSFAEAAEMATFGAKVLHPATLLPAVRSNI
PVYVGSSKAPEAGGTWVTRDPQPRPTFRAIALRRDQTLLTLSSLSMLHAQGFLANVFTIL
AKYKISVDTITTSEVSIALTLDKTGSASSGVELLSPELLEELSQYCTVKVDTGLSLVALI
GNDLHLASGVAKRIFDTLEGYNIRMISYGASTNNICMLAHSDKADDVVRSLHKSLFE

KEGG   T30319 (Metagenome): 15981
Entry
15981             CDS       T30319                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 125.946)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15981-T1-C
LinkDB
Position
C474744:complement(199..432)
AA seq 77 aa
AEIEHDLSIIMIVGEKMKSHIGVTATATKALSENNINIQMMSQGSSEVSIMFVVEKNQEK
AAIRALYRAFFEPQTQE

KEGG   T30319 (Metagenome): 4535
Entry
4535              CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 219.164)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.4535-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_4481:complement(3..350)
AA seq 116 aa
GWEHMPTGIDDLSIILRSRELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKS
HIGVTATATRALSENKINIQMMSQGSSEVSIMFVVHKNQEKAAIKALYNAFFGESK

KEGG   T30319 (Metagenome): 11857
Entry
11857             CDS       T30319                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 214.542)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.11857-T1-C
LinkDB
Position
C464823:2..334
AA seq 111 aa
IPSSYDKIEELNNGTEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFT
DVDGIFAAPPGIIHKPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKI

KEGG   T30319 (Metagenome): 10518
Entry
10518             CDS       T30319                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 201.83)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.10518-T1-C
LinkDB
Position
C461608:complement(2..313)
AA seq 104 aa
TNNPDHPGTRIVLEHSSDKFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEDLNI
GWEHMPTGIDDLSIILRSRELTPIKEEEILRQLVQKAEVDHAEI

KEGG   T30319 (Metagenome): 1465
Entry
1465              CDS       T30319                                 

Definition
hypothetical protein
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 45.4394)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.1465-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1609:254..325
AA seq 24 aa
MKVVKFGGSSLASAGQLEKVLNIV

KEGG   T30319 (Metagenome): 7806
Entry
7806              CDS       T30319                                 

Definition
aspartate kinase, monofunctional class
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 764.607)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.7806-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6744:complement(222..1517)
AA seq 431 aa
MSLIVQKFGGSSVADAEGIKRVARRIVDTQKAGNDVVVVVSAMGDTTDELLDLAAEVTSN
VTPSRELDMLLTAGERISTAILSMAVNDLGAKAQSFTGSQAGMITDGVHGSARLVEVNPE
RIRESIEAGNIAIVAGFQGVHRQSGDITTLGRGGSDTTAVALAAALKADVCEIYSDVDGV
FTADPRIVPTAHKLDTVTSEEMLEMAANGAKILHLRCVEYARRFNLKLHVRSSFSNLEGT
IVIPEDSAELTPTHLKEIPLEQPLISGVAHDRSQAKITVVGVPDVPGSAAKVFGLLNEAK
VNLDMIVQNVPTDRPNVTDISFTLDQAQGDAALKALKAAQAELGFQEVIYNESVGKLSLV
GAGMKTNPGVSFTFFDALSTAGVNIDMISTSEIRISVITELSKLDEAVRAVHTAFGLDAE
GEATVYGGTGR

KEGG   T30319 (Metagenome): 11217
Entry
11217             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 190.274)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.11217-T1-C
LinkDB
Position
C463318:complement(3..323)
AA seq 107 aa
LSEVTALAREKGFTEPDPRDDLSGQDVARKLLILAREAGLELELSDVEVEGVLPKGFSEG
KSADEFMAMLPQLDAEFKARVEAAKAEGKVLRYVGQIKDGHCKVSII

KEGG   T30319 (Metagenome): 7362
Entry
7362              CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 540.421)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.7362-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6501:3..893
AA seq 297 aa
THFNEAIEIFYNIINGLHAENNKFDLAGTKALIDAEFAQIKGLLEEIRQAGKVEDKVKAT
IDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAQGGYLESSVDIDESTKRVDAKSIGK
DKVVLMAGFTACNDKGELVLLGRNGSDYSAACLAACLDASVCEIWTDVDGVYTCDPRLVP
DARLLPSLSYREAMELSYFGAKVIHPRTIGPLLPKQIPCVIKNTGNSSAPGSIIDGHVKS
EGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKAGISVILITQSSSEYSI

KEGG   T30319 (Metagenome): 20362
Entry
20362             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
rpne:NCTC8284_03341 (best score: 296.975)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.20362-T1-C
LinkDB
Position
C484477:3..494
AA seq 163 aa
LSEVTALAREKGFTEPDPRDDLSGQDVARKLLILAREAGLELELSDVEVEGVLPKGFSEG
KSADEFMAMLPQLDAEFKARVEAAKAEGNVLRYVGQIKDGHCKVSIIAVDQNNPLYKVKD
GENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRTLHH

KEGG   T30319 (Metagenome): 7363
Entry
7363              CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
hin:HI0089 (best score: 573.933)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.7363-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6502:3..959
AA seq 319 aa
THFNEAIEIFYNIINGLHAENNKFDLAGTKALIDAEFAQIKGLLEEIRQAGKVEDKVKAT
IDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAQGGYLESSVDIEESTKRVDAKSIGK
DKVVLMAGFTACNDKGELVLLGRNGSDYSAACLAACLDASVCEIWTDVDGVYTCDPRLVP
DARLLPSLSYREAMELSYFGAKVIHPRTIGPLLPKQIPCVIKNTGNSSAPGSIIDGHVKS
EGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKAGISVILITQSSSEYSISFC
VPVKSADAAKAILEQEFAT

KEGG   T30319 (Metagenome): 15422
Entry
15422             CDS       T30319                                 

Gene name
thrA
Definition
bifunctional aspartokinase/homoserine dehydrogenase
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Best hit
rpne:NCTC8284_03341 (best score: 126.331)
Taxonomy
Gammaproteobacteria - Others [GN:rpne]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15422-T1-C
LinkDB
Position
C473433:complement(221..412)
AA seq 63 aa
HCKVSIIAVDQNNPLYKVKDGENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRT
LHH

DBGET integrated database retrieval system