KEGG   T30319 (Metagenome): 491
Entry
491               CDS       T30319                                 

Gene name
fabG
Definition
3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
spy:SPy_1749 (best score: 305.449)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.491-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_599:complement(3..611)
AA seq 203 aa
MQLKNKNIFITGSSRGIGLAIAHKFAQAGANIALNSRGAISEELLAEFSNYGVKVVPISG
DVSDFTDAKRMVDQAIAELGSVDVLINNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMT
QSVLKPMIKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVANRNIRVNA
IAPGMIESDMTAVLSDKVKDAML

KEGG   T30319 (Metagenome): 18633
Entry
18633             CDS       T30319                                 

Gene name
fabG
Definition
3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
lla:L0185 scl:sce8666 (best score: 45.8246)
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.18633-T1-C
LinkDB
Position
C480735:complement(456..554)
AA seq 32 aa
GQAEHIADATVFLAGQDYLTGQVLAVDGGLSM

KEGG   T30319 (Metagenome): 5936
Entry
5936              CDS       T30319                                 

Gene name
fabG
Definition
3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
hin:HI0155 (best score: 253.062)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.5936-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5621:389..817
AA seq 143 aa
MQNKIALVTGATRGIGRAIAEELASKGAFVIGTATSEKGADTISAYLGDKGKGLVLNVAD
KESIDAVLEQIKEQFGDIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVFHLSKAML
RSMMKKRFGRIITIGSVVGSMGN

KEGG   T30319 (Metagenome): 14932
Entry
14932             CDS       T30319                                 

Definition
3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
rmu:RMDY18_10770 (best score: 240.35)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.14932-T1-C
LinkDB
Position
C472293:3..401
AA seq 133 aa
GIGYKIAQEFKASGHNVCVTYRSGEAPTEFFAVKADVRDADSINEAFKTIEAEYGPVEIL
VANAGITRDMLLMRMKETDFMDVIDTNLTGSFRVAQRAIKGMIKLKRGRIILVSSVVGLY
GSPGQVNYSSSKA

KEGG   T30319 (Metagenome): 988
Entry
988               CDS       T30319                                 

Definition
oxidoreductase, short chain dehydrogenase/reductase family
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
spy:SPy_0440 (best score: 182.185)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.988-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1118:3..347
AA seq 115 aa
KGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVYGIAPGAVKTAMT
VADFEPGGLADWVASETPIKRWIEPEEIAEISLFLASGKASAMQGQILTIDGGWS

KEGG   T30319 (Metagenome): 12408
Entry
12408             CDS       T30319                                 

Gene name
fabG
Definition
3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
spy:SPy_1749 (best score: 169.474)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.12408-T1-C
LinkDB
Position
C466205:3..344
AA seq 114 aa
FITGSSRGIGLAIAHKFAQVGANIVLNSRGAISEDLLAEFANYGVKVVPISGDVSDFADA
KRMVDQAIAELGSVDVLVNNAGITQDTLMHKMTEADFEKVLKVNLTGAFNMTQS

KEGG   T30319 (Metagenome): 18294
Entry
18294             CDS       T30319                                 

Definition
short chain dehydrogenase/reductase family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
rmu:RMDY18_10740 (best score: 221.09)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.18294-T1-C
LinkDB
Position
C479999:154..534
AA seq 127 aa
MSQLAGKTVIITGSSRGVGADTAQILAAQGANIIVNYRSKAPRANKVVKAIEEAGGHATA
VQADVTKSEDLTNLVNVAIETYGSLDYLILNASGGMETGMGEDYAMRLNRDAQLNLARLA
AEKMPNG

KEGG   T30319 (Metagenome): 836
Entry
836               CDS       T30319                                 

Definition
dehydrogenase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Best hit
rmu:RMDY18_10770 (best score: 459.529)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00061  Fatty acid biosynthesis
00333  Prodigiosin biosynthesis
00780  Biotin metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01212  Fatty acid metabolism
Other DBs
HMP: SRS016533.836-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_993:complement(4841..5557)
AA seq 238 aa
MSENTPKTVLVTGGNRGIGYEIAKEFQAAGHNVCITYRSGEAPEEFFAVKADVRDADSIN
EAFKAIEAEFGPVEVLVANAGITRDMLLMRMKESDFTDVVDTNLTGSFRVVQRAIKGMLK
LKRGRIILVSSVVGLYGSPGQVNYSASKAALVGMARSITRELGGRNITANVVAPGFINTA
MTEVLPEETKKNYLASIPAGRFAEAQEVARVIRWLASDEASYISGAVIPVDGGLGMGH

DBGET integrated database retrieval system