KEGG   T30319 (Metagenome): 6110
Entry
6110              CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
rmu:RMDY18_09220 (best score: 1094.72)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.6110-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5768:677..2395
AA seq 572 aa
MTMTKKPFPSDLEIALAADLWPINKIAADNGISEDRLEPYGKYVAKVLLDETTNAETARK
RGSKYIVVTAVTPTPLGEGKTATSVSLAQGFAQTGRKAILALRQPAMGPTFGIKGGAAGG
GYSQIVPMEKLNLHLTGDFHAVTAAHNLLAAMIDNHLHHGNELRIDPRAIEWRRVIDMND
RSLRNIVVGLGERMDGVVRETGFDITSASEIMVILSLATSFKDLRERLAKIVIGLNYDGE
PVTAADLKADGAMSVILADAINPNLLQTLEHTPALIHAGPFGNIATGNSSVVADYVGLEY
SDYVITEAGFGADMGAERFFNVKCRVSGLKPDAAVLVVTVRSLKSHSGLYKIVPGKPLPE
GMLQESPSDVEKGAENLKKHIEIVRNFGVQPVVAINAFPTDFESEHETIRRIAEEAGARV
AIHRGVAEGGKGTTDLADVVAEACDDVSDLKYTYDLEDSIETKIEKVATKVYGADGISIA
PAAAKQLKRFAELGYSHLPVVIAKTHLSISSDATLKGAPTGWTLPVREVRLAAGAGYVYA
ICGTMRTMPGLSKSPAAERIGFDENGVMVGLS

KEGG   T30319 (Metagenome): 11492
Entry
11492             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
aos:AXE84_00360 (best score: 203.756)
Taxonomy
Actinobacteria [GN:aos]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.11492-T1-C
LinkDB
Position
C463944:2..328
AA seq 109 aa
TRLDQQAVLTLRQSAMGPTFGIKGGAGGSGGARILPADRMNLHLTGDFHAITAAHNLLSA
MIDNHLHHGNELDIDERTITWPRVLDVNDRALRHIVTGLGARIDGVTRQ

KEGG   T30319 (Metagenome): 16389
Entry
16389             CDS       T30319                                 

Gene name
fhs1
Definition
formate--tetrahydrofolate ligase 1
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
sdq:SDSE167_2157 (best score: 129.413)
Taxonomy
Firmicutes - Bacilli [GN:sdq]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.16389-T1-C
LinkDB
Position
C475648:complement(2..253)
AA seq 84 aa
MVLSDIEIANSVQMKPIMEIAAELGLTEDDISLYGKYKAKIDSNQLEQLKDKEDGKLILV
TAISPTPAGEGKTTTSVGLVDALS

KEGG   T30319 (Metagenome): 16441
Entry
16441             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
spy:SPy_1213 (best score: 75.485)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.16441-T1-C
LinkDB
Position
C475762:complement(1..147)
AA seq 49 aa
MKTDIEIAQSIELKPITDVVEKLGIHFDDLELYGKYKAKLTFDKIQAVQ

KEGG   T30319 (Metagenome): 10378
Entry
10378             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
pof:GS400_10640 (best score: 68.9366)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.10378-T1-C
LinkDB
Position
C461274:3..119
AA seq 38 aa
AGFIVALTGDVMTMPGLPKRPAALNMDVESDGTVLGLF

KEGG   T30319 (Metagenome): 16565
Entry
16565             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
rmu:RMDY18_09220 (best score: 261.151)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.16565-T1-C
LinkDB
Position
C476066:2..451
AA seq 150 aa
PGKPLPEGMLEENPADVEAGATNLKKHIEIVRDFGVQPVVAINAFPTDFDSEHEAIRRIA
EEAGARVAIHHGVAEGGKGTVDLANVVAEACDDVSNLEYTYDLEDSLETKLEKVATKVYG
ADGISIAPAAAKQLKRFADLGYSQLPVVIA

KEGG   T30319 (Metagenome): 16434
Entry
16434             CDS       T30319                                 

Gene name
fhs2
Definition
formate--tetrahydrofolate ligase 2
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
spy:SPy_2085 (best score: 176.792)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.16434-T1-C
LinkDB
Position
C475750:complement(139..447)
AA seq 102 aa
VYGGKGISLTPAAKRELKELEALGFSNYPICMAKTQYSFSDDAKKIGAPKDFTVKISNLK
VAAGAGFIVALTGTIMTMPGLPKVPASEKIDIDAQGNITGLF

KEGG   T30319 (Metagenome): 17892
Entry
17892             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
rmu:RMDY18_09220 (best score: 319.701)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.17892-T1-C
LinkDB
Position
C479047:complement(3..509)
AA seq 169 aa
GLGERIDGVPRQTGFDITSASEIMVILSLATSFEDLRKRLAKIVIGLNYDGEAVTAADLK
ADGAMAVILADAINPNLLQTLEHTPALIHAGPFGNIATGNSSVVADYVGLEYSDYVITEA
GFGADMGAERFFNVKCRTSGLKPDAAVLVVTVRSLKSHSGLYKIVPGKP

KEGG   T30319 (Metagenome): 19529
Entry
19529             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
gmo:NCTC11323_00817 (best score: 330.487)
Taxonomy
Firmicutes - Bacilli [GN:gmo]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.19529-T1-C
LinkDB
Position
C482703:2..622
AA seq 207 aa
GADLGAEKFLNIKCRKAGLKPKAAVVVATVKALKLHGDIEEKDLKEENLEALAKGVQNLE
KHIENLRKFNLPIVVALNVFVTDTEKELAFLENWAKEQGVEFSRTEVWEKGGLGGVDLAE
KVVKAVEENDKELQLLYKDEASITEKIETVCREIYGADGVNFSDEVKAEIERIERLGFKD
LPVCMAKTPASLTDNAKVKGRPTGFNI

KEGG   T30319 (Metagenome): 7593
Entry
7593              CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
spy:SPy_1213 (best score: 78.1814)
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.7593-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_6626:256..414
AA seq 53 aa
MKTDIEIAQNIELKPIVDVVEKLGISYDDLELYGKYKAKLSFDKIRAVESNPV

KEGG   T30319 (Metagenome): 21001
Entry
21001             CDS       T30319                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Best hit
rmu:RMDY18_09220 (best score: 144.05)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00670  One carbon pool by folate
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS016533.21001-T1-C
LinkDB
Position
C485837:complement(594..815)
AA seq 73 aa
VVIAKTHLSISSDASLKGAPTGWTLPVREVRLAAGAGYVYAICGTMRTMPGLSKSPAAER
IGFDENGTMIGLS

KEGG   T30319 (Metagenome): 227
Entry
227               CDS       T30319                                 

Gene name
folD
Definition
bifunctional protein folD
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Best hit
siv:SSIL_1698 (best score: 56.9954)
Pathway
00670  One carbon pool by folate
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS016533.227-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_292:complement(289..396)
AA seq 35 aa
LASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK

DBGET integrated database retrieval system