KEGG   T30319 (Metagenome): 8808
Entry
8808              CDS       T30319                                 

Definition
homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 706.057)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.8808-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_7079:complement(2..1129)
AA seq 376 aa
MSHNQTELLKKSLAERILILDGAMGTMIQKYKLTEADFRGERFKESAVDLRGNNDLLTLT
QPLLISAIHEKYLQAGADIIETNTFSSTTIAQADYDLQSIAYELNFAGAKLARLAADKYN
TPEKPRFVAGVLGPTNRTASISPDVNDPGFRNVTFMELVDAYAEATKGLIKGGADLIMIE
TIFDTLNAKAAIFAIETVFEELGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAKPL
TFGLNCALGPKELRQYVEQLSKISETYVSVHPNAGLPNAFGGYDLGAEEMAAHLKEWAES
GFVNIVGGCCGTTPEHIKAFADAMQGIAPRKLPEIKTAMRLSGLEPLNIDDESLFVNVGE
RNNVTGSAKFKRLIKE

KEGG   T30319 (Metagenome): 432
Entry
432               CDS       T30319                                 

Definition
methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 721.465)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.432-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_530:183..1310
AA seq 376 aa
MSHNQTELLKKSLAERILILDGAMGTMIQKYKLTEADFRGERFKESAVDLRGNNDLLTLT
QPLLISAIHEKYLEAGADIIETNTFSSTTIAQADYDLQSIAYELNFAGAKLARLAADKYS
TTEKPRFVAGILGPTNRTASISPNVNDPGFRNVTFMELVDAYSEATRGLIEGGADLIMIE
TIFDTLNAKAAVFAIETVFEELGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAKPL
TFGLNCALGPKELRQYVEQLSKISETYVSVHPNAGLPNAFGGYDLGAEDMATHLKEWAES
GFVNIIGGCCGTTPEHIKAFAEAVENIPPRKLPQIKTAMRLSGLEPLNIDDESLFVNVGE
RNNVTGSAKFKRLIKE

KEGG   T30319 (Metagenome): 22639
Entry
22639             CDS       T30319                                 

Definition
uncharacterized protein HI_1042
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
hic:NTHIC486_01747 (best score: 229.565)
Taxonomy
Gammaproteobacteria - Others [GN:hic]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.22639-T1-C
LinkDB
Position
C489123:complement(1527..1850)
AA seq 107 aa
QEEFDNQGLINENYVGIRPAPGYPSCPEHTEKALIWDLLEVEQRIGMKLTESYAMWPAAS
VCGWYFTHPASNYFTLGRIDEDQAQDYAKRKGWDEREMMKWLGVAMK

KEGG   T30319 (Metagenome): 20142
Entry
20142             CDS       T30319                                 

Definition
methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 444.891)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.20142-T1-C
LinkDB
Position
C484031:complement(2..682)
AA seq 227 aa
IEIAIDQVENGAQVIDVNMDEALLDGKKCMTRFLNIMATEPDAAKVPVMIDSSKWEVIEA
GLQSVQGKPIVNSISLKEGEEIFIEHAKLVRKYGAAVVVMAFDEVGQADTEDRKVEICTR
AYNILVNQLGFPPEDIIFDPNIFAIGTGIEEHNNYGVDFINATGRIKRSLPHAKISGGVS
NVSFSFRGNNVMREAIHAVFLYHAIKQGMDMGIVNAGQLAIYDDLDP

KEGG   T30319 (Metagenome): 6149
Entry
6149              CDS       T30319                                 

Definition
uncharacterized protein HI_1042
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 484.182)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.6149-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5801:3..734
AA seq 244 aa
ATTSKEHTAIKLYPKYKQHGVFYTSNASRAVTVCATLMNPEGRAALWEQFKKDYEKIQQS
FANRKPLRKQLSIEEARANRFDGFRGEWADYVPPTPKQTGIVEFKNVPIAELRKFIDWSP
FFRVWGLMGGYPDAFEHPESGEEARRVWNDAQAMLDAFEQNHKLNPSGVLGIFPAERVGD
DVVLFSDEDRTKTIGTAYGLRQQTERGKNSKSQFNFALSDFIADRESGKKDWMGMFAVCA
GIEE

KEGG   T30319 (Metagenome): 20364
Entry
20364             CDS       T30319                                 

Definition
homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
apor:DDU33_06390 (best score: 454.521)
Taxonomy
Gammaproteobacteria - Others [GN:apor]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.20364-T1-C
LinkDB
Position
C484481:complement(2..712)
AA seq 237 aa
LIKEDKFAEAIEIAIDQVENGAQVIDVNMDEALLDGKKCMTRFLNIMATEPDAAKVPVMI
DSSKWEVIEAGLQSVQGKPIVNSISLKEGEEKFIHQAKLVRKYGAAVVVMAFDEVGQADT
EDRKVEICSRAYDILVNQVGFPPEDIIFDPNIFAIGTGIEEHNNYGVDFINATGRIKRAL
PHAKISGGVSNVSFSFRGNNVMREAIHAVFLYHAIKQGMDMGIVNAGQLAIYDDLDP

KEGG   T30319 (Metagenome): 19696
Entry
19696             CDS       T30319                                 

Definition
homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 399.438)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.19696-T1-C
LinkDB
Position
C483115:3..638
AA seq 212 aa
LDIAEKYRNQGNDESAVDSVAEWRTWPVEERLKHALVKGITTYIVEDTEEARQTLPSPLD
VIEGPLMAGMDVVGDLFGDGKMFLPQVVKSARVMKQSVAYLEPFINATKQKGSSNGKVVI
ATVKGDVHDIGKNIVSVVMQCNNFEVIDLGVMVPADKIIQTAIDEKADIIALSGLITPSL
DEMEYFLGEMTRLGLNLPVMIGGATTSKEHTA

KEGG   T30319 (Metagenome): 5203
Entry
5203              CDS       T30319                                 

Definition
uncharacterized protein HI_1042
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 571.237)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.5203-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5032:complement(3..890)
AA seq 296 aa
TTSKEHTAIKLYPKYKEHGVFYTSNASRAVTVCATLMNPESRAALWEQFKKDYEKIQQSF
SNRKPLRKQLSIEEARANRFDGFSGEWADYVPPKPNQTGIVEFKNVPIATLRKFIDWSPF
FRIWGLMGGYPDAFDYPEGGEEARKVWNDAQVVLDELEQNHKLNPSGILGIFPAERVGDD
VVLFADEDRTQTIGTAYGLRQQTERGKNSKSQFNFALSDFIADRKSGKKDWFGMFAVCAG
IEEMELVEGYKAAGDDYNAILLQAVGDRLAEAMAEYLHFELRTRIWGYTQEEFDNQ

KEGG   T30319 (Metagenome): 19650
Entry
19650             CDS       T30319                                 

Definition
homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
aap:NT05HA_0674 (best score: 395.971)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.19650-T1-C
LinkDB
Position
C482993:complement(3..632)
AA seq 210 aa
LDIAEKYRNQSNDESAVDSVAEWRTWPVEERLKHALVKGITTYIIEDTEEARQQFASPLE
VIEGPLMAGMDVVGDLFGDGKMFLPQVVKSARVMKQSVAYLEPFINATKQKGSSNGKVVI
ATVKGDVHDIGKNIVSVVLQCNNFEVIDLGVMVPADKIIQTAIDEKADLIGLSGLITPSL
DEMEYFLGEMTRLGLNLPVLIGGATTSKEH

KEGG   T30319 (Metagenome): 2843
Entry
2843              CDS       T30319                                 

Definition
uncharacterized protein HI_1042
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Best hit
hic:NTHIC486_01747 (best score: 229.565)
Taxonomy
Gammaproteobacteria - Others [GN:hic]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.2843-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_3002:complement(2091..2414)
AA seq 107 aa
QEEFDNQGLINENYVGIRPAPGYPSCPEHTEKALIWDLLEVEQRIGMKLTESYAMWPAAS
VCGWYFTHPASNYFTLGRIDEDQAQDYAKRKGWDEREMMKWLGVAMK

KEGG   T30319 (Metagenome): 17380
Entry
17380             CDS       T30319                                 

Definition
methylenetetrahydrofolate reductase (NAD(P)H)
  KO
K24042  methionine synthase / methylenetetrahydrofolate reductase(NADPH) [EC:2.1.1.13 1.5.1.20]
Best hit
gmo:NCTC11323_01386 (best score: 296.975)
Taxonomy
Firmicutes - Bacilli [GN:gmo]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.17380-T1-C
LinkDB
Position
C477885:3..482
AA seq 160 aa
PSKLGDFPGATSVYDMTSLKLIPFIKQLNEGLGYNGASLKKTTNFTVAAAYNPNVRDLSK
TKRLVEKKIKAGTDYFITQPVFEAEKIEQLAEFAADYPDTPFFVGIMPITSYNNAVFLHN
EVPGIKLSEEFLAKLEEVKDDKELCQKIALEESKKLLDVA

KEGG   T30319 (Metagenome): 13022
Entry
13022             CDS       T30319                                 

Definition
methylenetetrahydrofolate reductase (NAD(P)H)
  KO
K24042  methionine synthase / methylenetetrahydrofolate reductase(NADPH) [EC:2.1.1.13 1.5.1.20]
Best hit
gmo:NCTC11323_01386 (best score: 211.075)
Taxonomy
Firmicutes - Bacilli [GN:gmo]
Pathway
00270  Cysteine and methionine metabolism
00450  Selenocompound metabolism
00670  One carbon pool by folate
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.13022-T1-C
LinkDB
Position
C467727:complement(2..355)
AA seq 118 aa
IRAAEIARKAAGENTFVFGTIGAIRGLRECELSLETIVNETLDQVKVLLSTNKIDALLFE
TYYDQEEIRAVLTEARKLTDLPIITNISLLEAGITQNGEKVTDALSTLVNLGADIVGL

DBGET integrated database retrieval system