KEGG   T30319 (Metagenome): 920
Entry
920               CDS       T30319                                 

Definition
protein tabA
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 223.787)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.920-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_1026:complement(2..340)
AA seq 113 aa
LSGGIGVNYRPDQEPNDIALIGEGVRKVYEEVLTPAGLGQVKIFTELGRFMLAPHGALVT
RVTHKKETYRTYLGVDASAVNLMRPAMYGAYHHITNMTHPDGPAEVVDVVGSL

KEGG   T30319 (Metagenome): 15635
Entry
15635             CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 258.455)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15635-T1-C
LinkDB
Position
C473926:complement(3..419)
AA seq 139 aa
KVAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEAREVYKLAATLSHVKITGMDCHIG
SQLTELQPFLDATDRLIRLMEQLKEDGITLKHLDLGGGLGVTYTDETPPHPSDYATALLN
KLKDYEDLEIILEPGRAIA

KEGG   T30319 (Metagenome): 15580
Entry
15580             CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
rmu:RMDY18_13100 (best score: 217.624)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15580-T1-C
LinkDB
Position
C473788:complement(3..419)
AA seq 139 aa
ASTHESIATAHEDQKFGMSLQPGTARLAGLEADELEYWSTTEDESYAMLAAGILTATDSL
DFRGIHCHIGSQIFEAQGFEQAADTVLTFMHAVNQKYGISLPELDLGGGYGIGYTEADTP
RSIEQITVSIADAVAATCE

KEGG   T30319 (Metagenome): 15567
Entry
15567             CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
rmu:RMDY18_13100 (best score: 267.314)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15567-T1-C
LinkDB
Position
C473760:complement(3..419)
AA seq 139 aa
ATCERLGMTIPHMSFEPGRSISGPSGVTLYTVGTIKNVSIEDEHGQIRVRRYVSVDGGMS
DNARPVLYDADYAVTLANRAPAGAQVLSRVVGKHCESGDIVVRYCYLPADLRAGDILAVP
ATGAYCYVLGSNYNYLSRP

KEGG   T30319 (Metagenome): 22479
Entry
22479             CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
rmu:RMDY18_13100 (best score: 674.47)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.22479-T1-C
LinkDB
Position
C488817:complement(554..1597)
AA seq 347 aa
SVDELKLIERVYAELAAERVAEGEEPYAPVPVLIRITPGVHASTHESIATAHEDQKFGMS
LQPGTAALAGLDEEELEHWGVESTDSYAALAAAILNATDSLDFRGIHCHIGSQIFEAEGF
EQAATTALEFMNRLNRDLGVTLPELDLGGGYGIGYTEADRPRSITEVTESIAASVAATCE
RLGMAIPHMSFEPGRSISGPSGATLYTVGTIKNVSIEDENGEIRVRRYVSVDGGMSDNAR
PVLYESDYSVTLANRAPAGEQVLSRVVGKHCESGDVVVRYCYLPADLQAGDILAVPATGA
YCYVLGSNYNFLTRPPVIATAEGKPSRVMIRRQREEDMLALDMGSEI

KEGG   T30319 (Metagenome): 16370
Entry
16370             CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
acq:AM609_09520 (best score: 154.836)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.16370-T1-C
LinkDB
Position
C475598:130..444
AA seq 105 aa
MTDQIPAGEPPLGSLSCPEPEDRPDLWPTTARRTDDGELVLGGLTVSEILAEAPSPVFVL
DEADLRGRAASWAAAMHEEFWPSYGMAGGEAFYAGKAFLTTKVAQ

KEGG   T30319 (Metagenome): 11309
Entry
11309             CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gsa:FOC50_06230 (best score: 89.7373)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.11309-T1-C
LinkDB
Position
C463524:2..136
AA seq 44 aa
GAYNYSMSSNYNRLPKLPVVFVKDGTSRLVVKGETLEDLIRQDV

KEGG   T30319 (Metagenome): 5680
Entry
5680              CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
rmu:RMDY18_13100 (best score: 207.994)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.5680-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_5426:1..399
AA seq 133 aa
PAELNRTIWTDSFQRNHGGELTIDGIAASELVKEFDTPQYVFSEDTFRARARGYRQAFED
AFARYGAQVSVYYAGKSFLCTSVARWAHEEGLCLDTASGGELAIALRAQVPGENIALHGN
NKSRGEIARAIKH

KEGG   T30319 (Metagenome): 765
Entry
765               CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 242.662)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.765-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_923:3..413
AA seq 136 aa
ANAGILVAKVQYLKTNESRNFAITDTGMNDMIRPALYEAYMNIIEIDRTLERERAIYDVV
GPVCETSDFLGKQRELAIAEGDYIAQRSAGAYGASMSSNYNSRPRTAEVLVDGDKVHLIR
RRENLSELWALESIAE

KEGG   T30319 (Metagenome): 21867
Entry
21867             CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 640.958)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.21867-T1-C
LinkDB
Position
C487571:3..1040
AA seq 345 aa
DCSSYVELLMSHKLGFTGSEMMFSSNNTPDQEYAYARELGATINLDAFEDIAHLERAAGI
PEIISCRYNPGGVFELGTDIMDNPGEAKFGMTKEQLFEAFALLKEKGARTFGIHSFLASN
TVTHLYYPELARQLFELAVEIKEKLGISLDFINLSGGIGVNYRPEQEPNDIALIGEGVRQ
VYEEVLTPTGLGQVKIFTELGRFMLAPHGILVTKVTHKKKTYRTYLGVDASAVNLMRPAM
YGAYHHITNMMNPDGQTEVVDVVGSLCENNDKFAVNRELPQTEIGDLLVIHDTGAHGFSM
GYQYNAKLRSAEVLYTEDGSARLIRRAERPEDYFATLYGFEFDKD

KEGG   T30319 (Metagenome): 2551
Entry
2551              CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 497.278)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.2551-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2700:complement(3..842)
AA seq 280 aa
MDFFQYKNEQLYVEDLPVKQLAEEFGTPLYIYSRATLERHWHAFDSALEKHPHLICYAVK
ANSNIGILNVMAKLGSGFDIVSQGELERVLAADGEASKVVFSGVAKSRAEIMRALEVGIR
CFNVESIAELHHINQIAGEMGKVAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE
VYKLAATLPHVKITGMDCHIGSQLTELQPFLDATDRLIRLMEQLKEDGITLKHLDLGGGL
GVTYTDETPPHPSDYATALLNKLKDYEDLEIILEPGRAIA

KEGG   T30319 (Metagenome): 15850
Entry
15850             CDS       T30319                                 

Definition
diaminopimelate decarboxylase, PLP-binding
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 183.341)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.15850-T1-C
LinkDB
Position
C474418:120..428
AA seq 103 aa
MDFFQYKNEQLYVEDLPVKQLAEEFGTPLYIYSRATLERHWHAFDSALGKHPHLICYAVK
ANSNIGILNVMAKLGSGFDIVSQGELERVLAAGGEASKVVFSG

KEGG   T30319 (Metagenome): 23386
Entry
23386             CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
rmu:RMDY18_13100 (best score: 302.367)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.23386-T1-C
LinkDB
Position
C490491:6959..7432
AA seq 158 aa
MSEARALYAPEWLTYPEHPEALSRTIWTDSFTRNEQGELCIDGVTVSDLVAEHETPQYVF
SETTFRARARAYRTAFEQAFATHGAKVSVYYAGKSFLSTAVARWATEEGLCLDTASGGEL
ALALRAQVPGANIALHGNNKSEAEIARAIRNGLGRVVA

KEGG   T30319 (Metagenome): 517
Entry
517               CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 241.506)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.517-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_635:complement(3..359)
AA seq 119 aa
WNKGFKEYFAVKATPTPAILKILQEEGCGVDCSSYVELLMSHKLNFPGSEIMFSSNNTPD
KEYAYARELGATINLDAFEDIEHLERAAGIPEIISCRYNPGGVFELGTDIMDNPGEAKF

KEGG   T30319 (Metagenome): 14876
Entry
14876             CDS       T30319                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 239.965)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.14876-T1-C
LinkDB
Position
C472161:complement(3..398)
AA seq 132 aa
ANAGILVAKVQYLKSNESRNFAITDTGMNDMIRPALYEAYMNIIEIDRTLGREKAIYDVV
GPVCETSDFLGKQRELAIAEGDYIAQRSAGAYGASMSSNYNSRPRTAEVLVDGNKAHLIR
RRENLSELWALE

KEGG   T30319 (Metagenome): 2348
Entry
2348              CDS       T30319                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 118.242)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016533.2348-T1-C
LinkDB
Position
SRS016533_Baylor_scaffold_2484:3..182
AA seq 59 aa
LVIHDTGAHGFSMGYQYNAKLRSAEILYTEEGKARQIRRAERPEDYFATLYGFDFESDH

DBGET integrated database retrieval system