KEGG   T30383 (Metagenome): 135706Help
Entry
135706            CDS       T30383                                 

Definition
UPI0001611891 related cluster
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Best hit
gfr:102040824 phi:102100951 (best score: 39.2762)
Pathway
04022  cGMP-PKG signaling pathway
04024  cAMP signaling pathway
04062  Chemokine signaling pathway
04071  Sphingolipid signaling pathway
04270  Vascular smooth muscle contraction
04350  TGF-beta signaling pathway
04360  Axon guidance
04510  Focal adhesion
04530  Tight junction
04611  Platelet activation
04670  Leukocyte transendothelial migration
04810  Regulation of actin cytoskeleton
04921  Oxytocin signaling pathway
05130  Pathogenic Escherichia coli infection
05131  Shigellosis
05132  Salmonella infection
05163  Human cytomegalovirus infection
05200  Pathways in cancer
05205  Proteoglycans in cancer
05206  MicroRNAs in cancer
Other DBs
HMP: SRS018665.135706-T1-C
LinkDB All DBs
Position
C3575237:complement(2..385)
AA seq 128 aa AA seqDB search
KKVREDNLSKEIDKKRKEDLKELEKEKEKEEKALEELKKEIEKINNQKIQNENEQKRLEL
ENKRISQFETILESKISEEKERERKKVEIELNQEKEKFEEISEKYKDVLEKLKKFNDISE
NYGSIENI

DBGET integrated database retrieval system