KEGG   T30383 (Metagenome): 194254Help
Entry
194254            CDS       T30383                                 

Definition
hypothetical protein
  KO
K04237  partitioning defective protein 3
Best hit
acs:100561891 (best score: 29.6462)
Pathway
04015  Rap1 signaling pathway
04062  Chemokine signaling pathway
04080  Neuroactive ligand-receptor interaction
04144  Endocytosis
04360  Axon guidance
04390  Hippo signaling pathway
04391  Hippo signaling pathway - fly
04520  Adherens junction
04530  Tight junction
05165  Human papillomavirus infection
Other DBs
HMP: SRS018665.194254-T1-C
LinkDB All DBs
Position
C3714463:complement(433..675)
AA seq 80 aa AA seqDB search
HGDGGILTRDGVRVPVLGAEDGAVEVFVQVGAANAAPGDLNEYFTGGYFGGRDVFDTNIV
AVIETSCLHGRLLNLGRWPL

DBGET integrated database retrieval system