KEGG   T30383 (Metagenome): 200864Help
Entry
200864            CDS       T30383                                 

Gene name
ntpK
Definition
V-type sodium ATPase subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
efa:EF1494 (best score: 103.605)
Taxonomy
Firmicutes - Bacilli [GN:efa]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.200864-T1-C
LinkDB All DBs
Position
C3728882:1..252
AA seq 83 aa AA seqDB search
FIMINMSASMTLAAGLYLFMAALPIAFTGLFSGIAQGKVAAAGVQILAKKPEESTKGIIF
AAMVETYAILGLLASILIIINKG

KEGG   T30383 (Metagenome): 80579Help
Entry
80579             CDS       T30383                                 

Gene name
atpK
Definition
V-type ATPase, subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
pgi:PG_1807 (best score: 201.445)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.80579-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_61133:complement(41..499)
AA seq 152 aa AA seqDB search
MNEMLSFLGIALMVGLTGIGSSIGVTICGNAAVGAMKKNPDAFGQYIGLSALPSSQGLYG
FVGFFMAKGVLEKLSAAGAITTFTAWAIFFTGVILGVVGAYSAIRQAQVCANGIQSIGNG
GNVFSATMVMAVFPELYAILALLATILTVLSL

KEGG   T30383 (Metagenome): 129201Help
Entry
129201            CDS       T30383                                 

Definition
V-type ATPase, subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
pgi:PG_1807 (best score: 149.828)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.129201-T1-C
LinkDB All DBs
Position
C3559147:complement(31..366)
AA seq 111 aa AA seqDB search
ALGQYIGLSALPSSQGLYGFVGFFMAKGALDKLIAAGPISSFAAWAILGAGIILGVVGAY
SAIRQAQVCANGIQAIGNGENVFSATMVMAVFPELYSILALLVAILTVNSL

KEGG   T30383 (Metagenome): 231501Help
Entry
231501            CDS       T30383                                 

Definition
V-type ATPase, subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
pdi:BDI_0831 (best score: 206.838)
Taxonomy
Bacteroidetes [GN:pdi]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.231501-T1-C
LinkDB All DBs
Position
C3791081:complement(483..905)
AA seq 140 aa AA seqDB search
MVGLSGIGSAFGLTICGNAVVGAMKKAPEKMGTYIALSALPSSQGLYGFVAYMMVQKFLV
ADMPWVTAAGIFGAGLIMGFAGFYSSVRQAHVCANGIAATGAGHNVFAATMVMAVFPELY
AILALVVSILISFTFPAVAA

KEGG   T30383 (Metagenome): 26554Help
Entry
26554             CDS       T30383                                 

Definition
H+transporting two-sector ATPase C subunit
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
lba:Lebu_0754 (best score: 287.345)
Taxonomy
Fusobacteria [GN:lba]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.26554-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_24197:complement(217..708)
AA seq 163 aa AA seqDB search
KLGGNKMNFSQFLVQNGGIVMATLGAALATLLAGIGSAKGVGIVGEVATGLMSEEPEKFG
KSLVLQLLPGTQGLYGFVIGLMVLGKLKPEMTLQTGLGILMACLPIAIAGYGSAIAQGRV
AASGISLLAKNEEQNTKGIIYSVMVETYALLAFVVSIMLLGRF

KEGG   T30383 (Metagenome): 191557Help
Entry
191557            CDS       T30383                                 

Gene name
ntpK2
Definition
V-type ATP synthase, subunit k
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
hsd:SD1D_0986 (best score: 71.2478)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.191557-T1-C
LinkDB All DBs
Position
C3708343:1..153
AA seq 50 aa AA seqDB search
EVSVASIMLVAKKPDQFGKAMIFPAMVETYAILALLVSILAVNAIGGLQI

KEGG   T30383 (Metagenome): 37649Help
Entry
37649             CDS       T30383                                 

Definition
hypothetical protein
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
axl:AXY_13290 (best score: 47.7506)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.37649-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_32881:complement(404..496)
AA seq 30 aa AA seqDB search
TKGIVYAVMVETYALLAFVISMIMVLLGVQ

KEGG   T30383 (Metagenome): 148127Help
Entry
148127            CDS       T30383                                 

Gene name
ntpK2
Definition
V-type ATP synthase, subunit k
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
rbp:B6259_01820 (best score: 134.42)
Taxonomy
Firmicutes - Clostridia [GN:rbp]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.148127-T1-C
LinkDB All DBs
Position
C3606051:105..419
AA seq 105 aa AA seqDB search
MSNVQNMGVVYALLGAALATLLAGIGSSIGVRKAGQAAAGVVSEDPSQFSKVLILQLLPG
TQGIYGLLIAFITLTQIGILGGNPEMSTAKGLLYLAACLPIAIVG

KEGG   T30383 (Metagenome): 94987Help
Entry
94987             CDS       T30383                                 

Gene name
ntpK
Definition
V-type sodium ATPase, K subunit
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
lba:Lebu_0754 (best score: 140.584)
Taxonomy
Fusobacteria [GN:lba]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.94987-T1-C
LinkDB All DBs
Position
C3473139:3..281
AA seq 92 aa AA seqDB search
YGFVIGLMVLGRLNPQMSIAEGIYIFIACLPIAIAGYGSAIFQGRVAASGISLLAKNEEQ
STKGIVYAVMVETYALLAFVVSIMLLSGVSFK

KEGG   T30383 (Metagenome): 23189Help
Entry
23189             CDS       T30383                                 

Gene name
atpK
Definition
V-type ATPase, subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
pgi:PG_1807 (best score: 206.453)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.23189-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_21226:2493..2951
AA seq 152 aa AA seqDB search
MNEMLSFLGIVLMVGLTGIGSSVGVTICGNAAVGAMKKNPDALGQYIGLAALPSSQGLYG
FVGFFMAKAALDKLIAAGPITSFAAWAILGAGIILGVVGAYSSIRQAQVCANGIQAIGNG
ENVFSTTMVMAVFPELYAILALLVTILIVGSF

KEGG   T30383 (Metagenome): 240101Help
Entry
240101            CDS       T30383                                 

Definition
hypothetical protein
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
spy:SPy_0149 (best score: 199.904)
Taxonomy
Firmicutes - Bacilli [GN:spy]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.240101-T1-C
LinkDB All DBs
Position
C3804771:complement(2039..2518)
AA seq 159 aa AA seqDB search
MEQLAAYFTEYGGAFFAGLAIAIAVIFSGMGSSRGVGTAGQAAAALLKEEPEKFAQALIL
QLLPGTQGLYGFVIGFFILLRMSAGVSLANGLAYVFVALPVGVVGYFSAKYQGNVATAGL
QILAKRPEHVMKGVILAAMVETYAILAFVVSFMLLTNVQ

KEGG   T30383 (Metagenome): 48031Help
Entry
48031             CDS       T30383                                 

Gene name
atpK
Definition
V-type ATPase, subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
pgi:PG_1807 (best score: 212.616)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.48031-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_40696:complement(9578..10036)
AA seq 152 aa AA seqDB search
MNEMLSFLGIALMVGLTGIGSSIGVTICGNAAVGAMKKNPDSLGQYIGLSALPSSQGLYG
FVGFFMAKSALDKLLAAGAITPFTAWAIFFTGLILGVVGAYSAIRQAQVCANGIQAIGNG
ENVFSATMVMAVFPELYAILALLVTILTVLSL

KEGG   T30383 (Metagenome): 13193Help
Entry
13193             CDS       T30383                                 

Gene name
ntpK
Definition
V-type two sector ATPase, V(0) subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Best hit
fnu:FN1740 (best score: 114.39)
Taxonomy
Fusobacteria [GN:fnu]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.13193-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_12405:1..198
AA seq 65 aa AA seqDB search
MAGLPVGFVGLRSALYQGQVAVAGINILAKNETHQTKGIILAVMVETYAILAFAMSFLLL
NQVKF

DBGET integrated database retrieval system