KEGG   T30383 (Metagenome): 32239Help
Entry
32239             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
cgl:NCgl0359 (best score: 340.502)
Taxonomy
Actinobacteria [GN:cgl]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.32239-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_28601:3..722
AA seq 239 aa AA seqDB search
GKITEKPLRDRPKHPTWVLKLSMAVTGLLFAAFVVFHMVGNLKVFLPAYEDGSRPINVYG
KWLREMFYPLLPHEAMLWIFRIVLLAAIILHIYGAFVLTGRSRKSRGKFRRTNLIGGMNS
FTSKTMLVTGIVLLAFIIFHILDLTLGVAPAAPTAFEHGHIYANMIASFSRWPVAIFYIL
AMVVLFLHLSHGIYLAVSDLGITGKRTRAVMLALSYLVPAVVMIGNISIPLSIALGLIH

KEGG   T30383 (Metagenome): 121314Help
Entry
121314            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pru:PRU_2433 (best score: 159.073)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.121314-T1-C
LinkDB All DBs
Position
C3539613:1..351
AA seq 117 aa AA seqDB search
YAFILTAQNRRARGDNRYAVTEKPATVEWASQNMLVLGIIVLLGLGLHLFNFWYNMMFAE
LTGMYVKIPPSHGFEYIQVTFANPVYVVLYIVWICALWFHLSHGFWSAMQTVGVNGK

KEGG   T30383 (Metagenome): 54320Help
Entry
54320             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
bth:BT_3053 (best score: 134.806)
Taxonomy
Bacteroidetes [GN:bth]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.54320-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_45485:2..337
AA seq 111 aa AA seqDB search
WAKMQLAELLGQHDLGISGVNGPADGAGLIRYTFSNPVFVVLYLVWLGALWFHLSHGFWS
SLHTIGFNNKIWFERLRNLSNIYTTIVILGFAVVVVYYFLQSLCGGACPFA

KEGG   T30383 (Metagenome): 80697Help
Entry
80697             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pgi:PG_1616 (best score: 268.47)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.80697-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_61188:complement(2..553)
AA seq 184 aa AA seqDB search
IKSSIGRKLVMSISGLALILFLTFHMSMNLVALFSEEGYNAICEFLGANWYALVGTMGLA
FLFIVHIVYAFILTYQNRKARGNDRYGVVDKPKGVEWASQNMMALGVVVILGLALHFFNF
WAKMQLAEIIGQHDLGIDGVSGPTDGAGLIRYTFSNPIFVVLYLVWLVALWFHLSHGFWS
SLHT

KEGG   T30383 (Metagenome): 103033Help
Entry
103033            CDS       T30383                                 

Definition
fumarate reductase transmembrane cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pru:PRU_2433 (best score: 133.265)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.103033-T1-C
LinkDB All DBs
Position
C3493687:complement(2..313)
AA seq 104 aa AA seqDB search
MWLINSSIGRKFVMSITGIALVLFLLFHGTMNFVAILSPESYNAICHFLGANWYALVGTV
GLALLVVLHFTFAFILTWQNYKARGRDRYDVASSRSEVSFASKN

KEGG   T30383 (Metagenome): 51040Help
Entry
51040             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome b558 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
rmu:RMDY18_16460 (best score: 108.997)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.51040-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_43100:851..1102
AA seq 84 aa AA seqDB search
MKSQELLSALPAEVKHTDPDVVSAATGGYSVLNSSKGTLYRGRWGMWSWVAHRVTGIAIF
FFLLVHVLDTAVVRISPEAYNSVL

KEGG   T30383 (Metagenome): 139074Help
Entry
139074            CDS       T30383                                 

Gene name
qcrB2
Definition
cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
acq:AM609_02215 (best score: 195.282)
Taxonomy
Actinobacteria [GN:acq]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.139074-T1-C
LinkDB All DBs
Position
C3583622:complement(2..313)
AA seq 104 aa AA seqDB search
MKRLMAWSGIVFILFVLFHAYGNTHYFQGEIAYDHYAVFLRALLVPILPYSGFLWILRAV
LVVLLLAHAGSAFYLWMRNRRARGTDRYAVKRPGADYFASRYAM

KEGG   T30383 (Metagenome): 65376Help
Entry
65376             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pgi:PG_1616 (best score: 324.324)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.65376-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_53046:complement(154..849)
AA seq 231 aa AA seqDB search
IKSSIGRKLVMSISGLALILFLTFHMSMNLVALFSEEAYNAVCEFLGANWYALVASIGLA
VLFLVHIIYAFILTVQNRKARGNDRYAVIDKPKGVEWASQNMMALGVIVLLGIFLHLFNF
WAKMQLAEIIGQHDLGIAGVAGPTDGAGLIRYTFANPIFVVLYLVWLGALWFHLSHGFWS
SLHTIGFNNKIWFERLRCLSNVYTTIIILGFAVVVVYYFLQSLCGGACPFA

KEGG   T30383 (Metagenome): 5352Help
Entry
5352              CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
nme:NMB0948 (best score: 207.994)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.5352-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_5025:171..548
AA seq 125 aa AA seqDB search
MSAKSRPVFLEIPNIRLPIPGIVSILHRISGVGLFVMLPVLLYFFSGTLDREASFEAYRS
AISNPFVKLILIGLLWAYLHHFFAGIRFLFLDVHKGLELNTARATAKVVFASALILTVVL
GALLW

KEGG   T30383 (Metagenome): 145795Help
Entry
145795            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
lmir:NCTC12852_01809 (best score: 244.202)
Taxonomy
Betaproteobacteria [GN:lmir]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.145795-T1-C
LinkDB All DBs
Position
C3600253:3..380
AA seq 125 aa AA seqDB search
VGLDQLLGHYLPAMAPAAQVSILHRASGALMFLIGIPFMLYLLSQSITSESSFEVYSAVV
HSWLGKLVLLVLIWSFCHHMAAGFRFIVLDMHFLTEKSKAMFSAKVVLAVSLTMTVIFGG
LLLLS

KEGG   T30383 (Metagenome): 44718Help
Entry
44718             CDS       T30383                                 

Definition
putative succinate dehydrogenease cytochrome B subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
cgl:NCgl0359 (best score: 231.876)
Taxonomy
Actinobacteria [GN:cgl]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.44718-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_38252:complement(2..457)
AA seq 152 aa AA seqDB search
MTVKYDDRDAIAHGKITEKPLRERPKFPTWALKLTMAITGLIFGGFVLIHMIGNLKVFMP
MHDGHYPIDQYGEFLREVGYPLIPHEGVLWIFRITLLASLILHVYGAFAITGRAHQSRGK
FRRTNLMGGLNSFTARTMIVTGIVLLAFIIFH

KEGG   T30383 (Metagenome): 86228Help
Entry
86228             CDS       T30383                                 

Definition
succinate dehydrogenase, subunit C
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
cje:Cj0439 (best score: 448.743)
Taxonomy
Epsilonproteobacteria [GN:cje]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.86228-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_63367:393..1250
AA seq 285 aa AA seqDB search
MQNEFAFFPGCVLSQAAKEAKMSLEAIAPILGWKLHEIKGWSCCGAQQAQDVDPIATLVA
NARNIALAEQMNMPMLTTCSTCMLTLTRAKTTLDKGAKDRINTFLAEGNMKYNGSTEITS
LLWVLYQNVETLRAKVVKPLSGLKVALFYGCHSLRPEKDLHNRESSVNPKSFETVVGALG
ATIVPFEKRLDCCGFHASYPAGTSVRKMSSQIVNNADENGADVVVTPCPLCQMQLDIYQE
RYQDENHSNVRKPIIHLSQLVGLALGLSVEDLGLDLNIIDATKIA

KEGG   T30383 (Metagenome): 216973Help
Entry
216973            CDS       T30383                                 

Definition
fumarate reductase transmembrane cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pru:PRU_2433 (best score: 166.007)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.216973-T1-C
LinkDB All DBs
Position
C3763309:3..323
AA seq 106 aa AA seqDB search
FWYNMMFAELTGMETKFHPADGFSYIQDTFANPVYVVLYVVWIVAIWFHLSHGFWSAMQS
LGINGKVWFERWKMIGQVYTTLLMLGFLVVVLAFAFGCAPSLCCHA

KEGG   T30383 (Metagenome): 138754Help
Entry
138754            CDS       T30383                                 

Definition
succinate dehydrogenase, cytochrome B subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 219.164)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.138754-T1-C
LinkDB All DBs
Position
C3582762:complement(2..391)
AA seq 130 aa AA seqDB search
TFNMLSHFMGTNPLIQFAMQPVLLAGVIFHFVMGFVLELQNKRARGNEPYYSYNGAANAS
WMSRNMAITGMVVLGFLALHLYDFWAPEMNYKYIEALPADETRYYGELVERFHSPVRVGI
YVLCFVFLCL

KEGG   T30383 (Metagenome): 137356Help
Entry
137356            CDS       T30383                                 

Definition
hypothetical protein
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
amy:ADJ76_00580 (best score: 231.876)
Taxonomy
Actinobacteria [GN:amy]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.137356-T1-C
LinkDB All DBs
Position
C3579307:1..387
AA seq 129 aa AA seqDB search
FVPIFPHGGFIWVFRAAMVLMLIIHLWAAAYTWKRSRRARSTRYVVKKSVSDSYAARTMR
MSGVLILLILIFHIAHFTTVSLPAKVANFGADVTTPYARMVASFQSPVLVILYAVFVGCA
CIHVSHGFW

KEGG   T30383 (Metagenome): 165882Help
Entry
165882            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
kki:KKKWG1_1541 (best score: 129.028)
Taxonomy
Betaproteobacteria [GN:kki]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.165882-T1-C
LinkDB All DBs
Position
C3648752:214..489
AA seq 92 aa AA seqDB search
MQTKKRPVFLDLQVLVRHLPVPGIVSILHRASGVILFIMIPVLLMLLNGSLSSGEDFESY
KAVADNPLVKLILIGVLWAFLHHLCAGIRFLL

KEGG   T30383 (Metagenome): 106887Help
Entry
106887            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pgi:PG_1616 (best score: 161.77)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.106887-T1-C
LinkDB All DBs
Position
C3503433:complement(1..321)
AA seq 107 aa AA seqDB search
LTFHMSMNLVALFSEEGYNAVCEFLGANWYALVATKGLALLFIVHIVYAFILTNQNRKAR
GNDRYDVIDRPKGVEWASQNMMVLGVIVLLGLGLHLFNFWAKMQLAE

KEGG   T30383 (Metagenome): 72417Help
Entry
72417             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 383.259)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.72417-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_57081:complement(730..1407)
AA seq 225 aa AA seqDB search
MAGLFKTSVARKMTMALSALFLIIFLVIHLAVNFMSVLSPSTFNVLSHFMGTNPLIQFAM
QPVLLAGVIFHFVMGFVLELQNKRARGSEPYYSYNGAANSSWMSRNMIITGMLVLLFLAL
HLWDFWVGEMNYKYIEQLAPNPERYYDELVEKFENPIRVGLYVLCFVFLCLHLLHGFQSA
FQSMGWKDDARKKLISQVGNWYSYIICGGFIFVALFHYFKHLLNA

KEGG   T30383 (Metagenome): 11641Help
Entry
11641             CDS       T30383                                 

Definition
succinate dehydrogenase
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 134.035)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.11641-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_11003:complement(3..245)
AA seq 81 aa AA seqDB search
MIISGIVILLFLGLHLYDFWVGEMNYKYIEQLAPDPTRYYDELVEKFHDPLRVGFYVLCF
VFLCLHLLHGFQSAFQSMGWK

KEGG   T30383 (Metagenome): 66997Help
Entry
66997             CDS       T30383                                 

Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 211.846)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.66997-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_54019:complement(3..317)
AA seq 105 aa AA seqDB search
KKARGSEAYYSYNGGANSTWMSRNMIITGVVILLFLGLHLYDFWVGEMNYKYIEQLPPNP
DRYYEELVEKFHNPVRVGIYVLAFIALALHLLHGFQSSFQSMGWK

KEGG   T30383 (Metagenome): 21454Help
Entry
21454             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 358.992)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.21454-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_19734:complement(325..993)
AA seq 222 aa AA seqDB search
MQIFKTSVARKVAMALSAFFLIIFLVIHLAVNFMSVLSPSTFNMLSHFMGTNPLIQFAMQ
PVLLVGVIFHFVMGFVLELQNKRARGNQPYYSYNGAANASWMSRNMIITGVVVLGFLALH
LFDFWAPEMNYKYIEALPADETRYYGELVERFHNPVRVGIYVLCFVFLCLHLLHGFQSAF
QSVGLKDDKRKKLISCLGNWYSYIICGGFIFVALFHYINSLL

KEGG   T30383 (Metagenome): 151014Help
Entry
151014            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 209.92)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.151014-T1-C
LinkDB All DBs
Position
C3612935:complement(2..430)
AA seq 143 aa AA seqDB search
VNFMSVLSEGTFNMLSHFMGTNPLIQFALQPVLLFGVVFHFVMGFVLELQNKRARGNQPY
YSYNGAANASWMSRNMIITGVVVLGFLALHLYDFWAPEMVYKYIDFNEPDETRYYGELIE
KFHDPIRVGIYVFCFVFLCLHLL

KEGG   T30383 (Metagenome): 52383Help
Entry
52383             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
pgi:PG_1616 (best score: 170.244)
Taxonomy
Bacteroidetes [GN:pgi]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.52383-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_44090:3..359
AA seq 119 aa AA seqDB search
NLVALFSEEAYNAVCEFLGANWYALVASMGLAVLFIVHIVYAFILTLQNRKARGNDRYDV
VDKPKGVEWASQNMMALGIIIVLGIFLHLFNFWAKMQLAEIIGQHDLGINGVTGPTDGA

KEGG   T30383 (Metagenome): 124747Help
Entry
124747            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
ssg:Selsp_1628 (best score: 168.318)
Taxonomy
Firmicutes - Others [GN:ssg]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.124747-T1-C
LinkDB All DBs
Position
C3548122:1..357
AA seq 119 aa AA seqDB search
HVFTNSTVLGGAKAFNDSLAMMELIPKPIFYGLEIFAIAVPLLFHAIYGIYIAAQAKNNP
SNYGYVRNWQFALQRYTAWILIPFLIWHVGYMRIWEKGMMGTHINYDLLYTYFVTGDYA

KEGG   T30383 (Metagenome): 17461Help
Entry
17461             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
actt:DDD63_03885 (best score: 205.682)
Taxonomy
Actinobacteria [GN:actt]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.17461-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_16275:complement(400..1116)
AA seq 238 aa AA seqDB search
VDTSLKQKRGLQTTVGFKVVMAFSGIVLVIFVLFHMYGNLKMFFGAESYNHYAEWLKHDL
LYPILPHGWFIWIFRICLLLFLLGHAGAAACLFLRNRRARGSHYKVTKGSKKKVPLASRT
MKIGGIFLLIFIVFHILHFTALAIQIGGDYHALTPYERMIVSFTPDNWASVAALVVYTAA
VAFLSFHVWHGAFSALATLGAARTGAQPFLRGLAALCGLALLIGFLAPPYAIAFGFIS

KEGG   T30383 (Metagenome): 145794Help
Entry
145794            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
lmir:NCTC12852_01809 (best score: 238.424)
Taxonomy
Betaproteobacteria [GN:lmir]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.145794-T1-C
LinkDB All DBs
Position
C3600251:3..380
AA seq 125 aa AA seqDB search
VGLDQLLGHYLPAMAPAAQVSILHRASGVLMFLIGIPFMLYLLSQSITSESSFEAYSAVV
HSWFGKLVLLVLIWSFCHHMAAGFRFIVLDMHFLTEKSKAMFSAKVVLAVSLTLTVIFGG
LLLLS

KEGG   T30383 (Metagenome): 165163Help
Entry
165163            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 279.641)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.165163-T1-C
LinkDB All DBs
Position
C3647010:3..485
AA seq 161 aa AA seqDB search
ELSHFMGTNPLIQFAMQPVLLAGVIFHFVMGFVLEIQNKRARGSEKYYAYNGGANSSWMS
RNMIITGVMILLFLGLHLWDFWVGEMNYKYIQFNEPNPTRYYHELIEKFHEPLRVGIYVL
CFVFLCLHLLHGFQSAFQSMGWKDNARKKLISQVGNWYSYI

KEGG   T30383 (Metagenome): 99034Help
Entry
99034             CDS       T30383                                 

Definition
hypothetical protein
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
amah:DLM_0348 (best score: 68.1662)
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.99034-T1-C
LinkDB All DBs
Position
C3483438:complement(178..309)
AA seq 43 aa AA seqDB search
CAGIRFLLLDAHQGLELQTCRKTAKLVLIISLSLTLVLGVALW

KEGG   T30383 (Metagenome): 37255Help
Entry
37255             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 326.25)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.37255-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_32576:complement(30..584)
AA seq 184 aa AA seqDB search
STFNMLSHFMGTNPLIQFAMQPVLLAGVVFHFVMGFVLELQNKRARGNEPYYSYNGAANS
SWMSRNMPITGIVILLFLGLHLYDFWVGEMNYKYIEGLPEDPNRYYPELVEKFHDLWRVV
LYVLAFVFLCLHLLHGFQSAFQSMGWKDDKRKKFISCLGNWYSYVICGGFIFVALFHFVK
HLIA

KEGG   T30383 (Metagenome): 184157Help
Entry
184157            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
rmu:RMDY18_16460 (best score: 228.794)
Taxonomy
Actinobacteria [GN:rmu]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.184157-T1-C
LinkDB All DBs
Position
C3691534:complement(132..545)
AA seq 137 aa AA seqDB search
MWSWVAHRVTGIAIFFFLLVHVLDTAVVRISPEAYNSVLSLYKNPIMGLGEMALVAAIVY
HAFNGIRIILIDFWGPATNSKVEHIQKPNKDGIIETSEKATYNHIKILWVVLVLWVIFVA
GFAVRHLPNVFAHIGGH

KEGG   T30383 (Metagenome): 130995Help
Entry
130995            CDS       T30383                                 

Definition
cysteine-rich domain protein
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
vpr:Vpar_1703 (best score: 201.06)
Taxonomy
Firmicutes - Others [GN:vpr]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.130995-T1-C
LinkDB All DBs
Position
C3563682:complement(80..373)
AA seq 97 aa AA seqDB search
GFHAVYPAHDSVMQMTGSINKDAATEGADCVVTPCPLCQMQLDMFQKEAKEVVGGGKDMP
ILHMSQLVGLALGISPAEMGMPKRHLTDTAAVTKFVG

KEGG   T30383 (Metagenome): 377Help
Entry
377               CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
ppc:HMPREF9154_0999 (best score: 299.286)
Taxonomy
Actinobacteria [GN:ppc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.377-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_438:47..589
AA seq 181 aa AA seqDB search
MTTTTVDVPVGTRRRGPSNFVLKHVMAVTGVLFVAFVAVHLFGNLKVYAGADAFNHYAAW
LREVGYPLLPKQSVLWALRIALAGSLLLHVSAALTLWLRGRRSRGAHRRGLHRNRTREAA
FMLPGGILILVFVLVHISDLTAGGPLASASFRHPDPEMHAYANLVASFSRPWMAIFYMVV
M

KEGG   T30383 (Metagenome): 53132Help
Entry
53132             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
ecor:SAMEA4412678_2120 (best score: 231.491)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.53132-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_44621:complement(406..783)
AA seq 125 aa AA seqDB search
MRTTNRPIFLDIISIRLPIPGIVSILHRISGVLLFISLPLLLWLLAGTLDNAAAFESYRA
FVAHPLVKIGLIGLLWAYLHHFFAGIRFLFLDAHKGLALNTARTTAKTVMALALICTAIL
GVWLW

KEGG   T30383 (Metagenome): 70747Help
Entry
70747             CDS       T30383                                 

Definition
succinate dehydrogenase, subunit C
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
cje:Cj0439 (best score: 449.899)
Taxonomy
Epsilonproteobacteria [GN:cje]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.70747-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_56172:1851..2720
AA seq 289 aa AA seqDB search
MSAQNEFAFFPGCVLSQAAKESKISLEAIAPILGIKLHEIKGWSCCGATQAQDVDPIATL
VANARNLALAEGMNMPVLTTCSTCFLTLTRAKTALDRGQKDRINTFLAKGNMQYQGTTEV
TSLLWVLYQNVETLRVKVVKPLSNLKVALFYGCHSLRPEKATQNRESSVNPKSFETVVEA
LGAKIVPFEKRLDCCGFHASYPAVKSVQKMSSQIVNNADENGADCIVTPCPLCQMQLDIY
QERYQDAQNSGARVPIIHLSQLVGLALGLSKEQLGFEHNIVNTNSVKVG

KEGG   T30383 (Metagenome): 54396Help
Entry
54396             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
coc:Coch_0242 (best score: 307.76)
Taxonomy
Bacteroidetes [GN:coc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.54396-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_45538:3..554
AA seq 183 aa AA seqDB search
TFNMLSHFMGTNPLIQFAMQPVLLIGVIFHFVMGFILELQNKKARGNQPYYSYNGAANAS
WMSRNMAITGMVILGFLALHLFDFWAPEMNYKYIEALPADETRYYGELVERFHNPVRVGI
YVLCFVFLCLHLLHGFQSAFQSMGWKDDKRKKFISCLGKWYSYVICGGFIFVALFHFVKH
LIA

KEGG   T30383 (Metagenome): 174057Help
Entry
174057            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
tfo:BFO_1636 (best score: 179.874)
Taxonomy
Bacteroidetes [GN:tfo]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.174057-T1-C
LinkDB All DBs
Position
C3668141:205..528
AA seq 108 aa AA seqDB search
MWLVKSSVGKKLVMSISGLFLIFFLLFHLSMNVAAVFSTDAYNMICGLLGANWYAVAATV
VLGGFVVLHFVYATMLTLQNRKARGNDRYAVNTRPAGVSWASQNMFAI

KEGG   T30383 (Metagenome): 99036Help
Entry
99036             CDS       T30383                                 

Definition
hypothetical protein
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
amah:DLM_0348 (best score: 68.1662)
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.99036-T1-C
LinkDB All DBs
Position
C3483440:complement(178..309)
AA seq 43 aa AA seqDB search
CAGIRFLLLDAHQGLELQTCRKTAKLVLIISLSLTLVLGVALW

KEGG   T30383 (Metagenome): 152924Help
Entry
152924            CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
rbc:BN938_0747 (best score: 134.806)
Taxonomy
Bacteroidetes [GN:rbc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.152924-T1-C
LinkDB All DBs
Position
C3617701:2..334
AA seq 110 aa AA seqDB search
WAKMQLAEIMGQHDLGIEGVSGPTDGAGLIRYTFSNPIFVVLYLVWLAALWFHLAHGFWS
SLHTIGFNNRVWFDRLHKISNIYATIIILGFAAVVVCYFFRSLCGGACSL

KEGG   T30383 (Metagenome): 50720Help
Entry
50720             CDS       T30383                                 

Gene name
sdhC
Definition
succinate dehydrogenase cytochrome B subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Best hit
ppc:HMPREF9154_1321 (best score: 393.66)
Taxonomy
Actinobacteria [GN:ppc]Taxonomy
Pathway
00020  Citrate cycle (TCA cycle)
00190  Oxidative phosphorylation
00650  Butanoate metabolism
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01130  Biosynthesis of antibiotics
01200  Carbon metabolism
Other DBs
HMP: SRS018665.50720-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_42837:274..939
AA seq 221 aa AA seqDB search
MAVTGLILIVFLLVHMYGNLKMFVGYEAFDHYAHWLKGLEVENGVTKAGGIMYPIMPAGQ
FIWVFRAALLLAIALHIWSAATLSIKTIKNRGDKYQVTKRQAQTYSSRTMRWGGVIILLF
VIFHLVQFTIVPGILGGHAAEPHTMVLAGFQQWWITALYAVSILFVCMHIRHGFWSAFAT
LGGNLSANSRKWLNIIALIVSVALYAGFMIMPLCVQFGILK

DBGET integrated database retrieval system