KEGG   T30383 (Metagenome): 55175Help
Entry
55175             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
fsl:EJO69_06170 (best score: 576.63)
Taxonomy
Actinobacteria [GN:fsl]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.55175-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_46081:complement(1397..2965)
AA seq 522 aa AA seqDB search
VVLGSAVVGVLFEAFLPRSARRGVQIVLSFAAVAGALGAVVWRLVHVRGAGPRFVAVAGG
SSSEVSKAAGKGTPPLIGTFVEDAPALVFQTVILVCALVALFVIADRTVSREGSFAASAA
TQPGSLEEREATAAGLEQTEVFPLALFAVGGMLAFTSAGDLLTLFIALEVLSLPLYVLCA
TARRRRALSQEAAMKYFLLGAFSSAFFLMGVALLYGYAGSLNYVAIATALINVTGMDYLL
VAGVVLVLVGLLFKVGAAPFHSWTPDAYQGAPTPITGFMAAGTKIAAFAAMLRFLYIVGR
GVEWEITPALWTIVIVTMLVGTVGGIVQSDVKRMLAYSSIAHAGFVLIGVSAFHSAAIEA
VAFYLLAYGLASVGAFGVVALVRERAEGAGIVGEATALDRWRGLGRKDPFLAGAMAIFLL
SFAGIPLTGGFIGKFQVFAAGIEGGLAVLVVLAVLASAATAFFYFRLILMMFFQEPDDYA
VPVASEGYSAVAIGVCAVGTLLLGIVPGPLMNFLGEAKAFML

KEGG   T30383 (Metagenome): 162330Help
Entry
162330            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 200.29)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.162330-T1-C
LinkDB All DBs
Position
C3640262:complement(53..472)
AA seq 139 aa AA seqDB search
VEQNNGGKTNIDDYNGFYQTNPRLSFLMTLAMFSLGGIPPFAGMFSKFFIFMSGVNGADI
NTTMGAWAYGVVFIALLNTVISLYYYLKIVKAMYIVRTDNPLPTFKSDCNTKFALAVCMA
GILLFGVCSFVYEWIAAAV

KEGG   T30383 (Metagenome): 35854Help
Entry
35854             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 233.032)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.35854-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_31448:complement(2..418)
AA seq 139 aa AA seqDB search
TFGLFIYSKPYNQARGIFKGEFYTLSLFALLGMSVMVSAAHFLTAYIGLELLSLSLYAMI
ALRRDSGRSAEAALKYFVLGALASGLLLYGISMVYGATGSLEFATVLASSYSELANEWLL
KLGLVFIVVAVAFKLGAVP

KEGG   T30383 (Metagenome): 101090Help
Entry
101090            CDS       T30383                                 

Definition
proton-translocating NADH-quinone oxidoreductase, chain N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 141.739)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.101090-T1-C
LinkDB All DBs
Position
C3488748:complement(3..311)
AA seq 103 aa AA seqDB search
STAINVMKTILAFGTFIVVLQSRVWAEKSGKEGEFYMLAVSTLLGMEVMMSAGNFLMFFL
GLEMASVPMACVIAFDAYRNNSAEAAAKFILTATFSSGVMLYG

KEGG   T30383 (Metagenome): 23128Help
Entry
23128             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ppc:HMPREF9154_2396 (best score: 321.627)
Taxonomy
Actinobacteria [GN:ppc]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.23128-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_21189:293..841
AA seq 183 aa AA seqDB search
MSPLEITVPVMEWMLEAPLIVLLVGATLGVLLEAVVPREYRYPAQTGLAMLTVLAAMGFT
AYNWVGGDFKIVAPGSIAVDGPTYFFWSLLLLVGLGGVALFAERAVAGGVSAFAASAATV
PGSPMEREAERQHREHTEIFPLILFALFGMLLFVAANDLLTLFVALEIFSLPLYLLSGMA
RRR

KEGG   T30383 (Metagenome): 118382Help
Entry
118382            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
bvs:BARVI_09990 (best score: 154.836)
Taxonomy
Bacteroidetes [GN:bvs]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.118382-T1-C
LinkDB All DBs
Position
C3532356:complement(3..344)
AA seq 114 aa AA seqDB search
PTSVTAYLSVVSKGAAAFALLFALFKVFGNIQGIWQGIVWGLSAVTITLGNLFALRQSDI
KRFLAFSSISQAGYIVLGIIANNPMGITATVFYVLVYVFSNLAAFAVISAVENE

KEGG   T30383 (Metagenome): 5531Help
Entry
5531              CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 164.851)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.5531-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_5209:400..786
AA seq 128 aa AA seqDB search
MNWSDLNLMPTMPEIVLLALLGVVLLADLWICDKNRYLTHLMSLGTVIIVAVTQLAVWEQ
GSVDAFHGMYIADGMSRLAKLVLYALTFGLFIYSKPYNQDRQIFKGEFYTLSXXXPCAVI
PVVLPRLR

KEGG   T30383 (Metagenome): 70061Help
Entry
70061             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ppc:HMPREF9154_2396 (best score: 523.857)
Taxonomy
Actinobacteria [GN:ppc]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.70061-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_55805:complement(122..1039)
AA seq 305 aa AA seqDB search
FSYAGVAQAIVADESPQVLLLAGLVMLAIGLLFKVGAVPFHTWTPDVYTGAPTPVTGFMA
IATKTAAVAALLRVFYVALGGARWDWQPIIATVAVATMVVGAVVGLVQQDIKRLLAYSSI
AHAGFILAGFVAAVGATAEGGVSSVGSISFYLLAYGFATLGGFGIITMVRRAGGEANGIA
AWRGLGRTSPFVAGVMTLFLLSFAGIPLTAGFVGKLVVFAAAWQGGYGWLVLVAVIASLV
AAFFYLKVVVAMWFKEPERGQQGRVAGASGWTWIVVAVSAVATIVLGLVPGSILDLAAGA
AQFIR

KEGG   T30383 (Metagenome): 126614Help
Entry
126614            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
kki:KKKWG1_0378 (best score: 183.341)
Taxonomy
Betaproteobacteria [GN:kki]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.126614-T1-C
LinkDB All DBs
Position
C3552748:1..360
AA seq 120 aa AA seqDB search
IFAFRILVSGLVLSKGDWQLMFAALAALSLLVGNLAAIMQTNVKRMFAFSTVSHMGFVLL
GFVGGQIGFQAAVFYAIVYTLMSLTGFGVLMAVSNQHHECNEIKDLAGLNQRNAWYAFLM

KEGG   T30383 (Metagenome): 27179Help
Entry
27179             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 228.794)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.27179-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_24716:1..450
AA seq 149 aa AA seqDB search
LVYVVANMSVFTIISAIEERNNGVTDMDAYNGLYSTNPKLAFLMTLALFSLGGIPPFAGM
FSKFFVFMAALEQGSAWAYAIVFIALINTVISLYYYLLIVKAMYINKSENPLPAFKSDNN
TRMALAICTLGVALFGVCSYVYDWIFAAL

KEGG   T30383 (Metagenome): 203068Help
Entry
203068            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
lmir:NCTC12852_02113 (best score: 456.447)
Taxonomy
Betaproteobacteria [GN:lmir]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.203068-T1-C
LinkDB All DBs
Position
C3733748:3..737
AA seq 244 aa AA seqDB search
PKLAAFALLFRLLGEAVIEMAGLWQQMLIILAVLSLGIGNIVAVAQTNLKRMLAYSTISQ
VGFVLLGLAGVYGGEGFPPSHEAFGNALFYMISYVLTTLGTFGLIQFLAREGFEAEEISD
FAGLARRSPWLAGVMLLLMFSLAGIPPLVGFYAKLAVLKSVVAAGYTWLAIYAVLMSLIG
AFYYIRVVKVMFFDKVEDDADIVVDGQARTLMAINGVAVLLLGLLPGPLMALCVAAIRSA
WHLG

KEGG   T30383 (Metagenome): 81975Help
Entry
81975             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nis:NIS_0302 (best score: 410.994)
Taxonomy
Epsilonproteobacteria [GN:nis]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.81975-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_61747:complement(3..1124)
AA seq 374 aa AA seqDB search
MNEIAFLDLKEISLSSVAPMLSMIIFALFILIVGTIKKDLSRNFYCVFCIIAIFVNLGLI
LDFNGLSLSFWDMLLVDGVSVISQVIILIASALFIPLALSTKEYFEYKIYEYYALFLFMI
AGFLFMVSSNNLLIIFLGLEISSLCLYTLIALHNKAKSVEAAIKYFAMGSLSAGFFAMAI
AMFYLATNSIDIARIGVIIKDLSLNQNLIILLGCVFIASAIGFKLSLIPFHTWIPDVYEG
SNAPLAGYMSIVPKVAGFIVALRIFAMLESSGISWIKDILYIIAVLTMSLANIMALVQKD
VKRMLAFSSIAHAGVVLCALVANSHEANVALFFYWIMFLFANLGAFSMLWVARCDDVVCW
DKRFKHPYEKFSGL

KEGG   T30383 (Metagenome): 113968Help
Entry
113968            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ecor:SAMEA4412678_0047 (best score: 202.601)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.113968-T1-C
LinkDB All DBs
Position
C3521260:complement(3..335)
AA seq 111 aa AA seqDB search
VYHGSSTAVTALVGTAPKIAAAVFAFRILVTGLGALHTDWVPMLNMLALASLLVGNLAAV
MQTNIKRMLAYSTVSHMGFVLLAFMGGLEGFSAALYYALTYALMALTGFGV

KEGG   T30383 (Metagenome): 103707Help
Entry
103707            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ecor:SAMEA4412678_0047 (best score: 170.629)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.103707-T1-C
LinkDB All DBs
Position
C3495375:complement(3..317)
AA seq 105 aa AA seqDB search
FYSLTMFALLGMCVMVSANHFLTLYIGLELLSLSLYALIALRREDTRASEAALKYFVLGA
LASGLLLYGISMIYGATGSLLLPEVLMAGLGQSANPWLLKLGLVF

KEGG   T30383 (Metagenome): 152080Help
Entry
152080            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 224.942)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.152080-T1-C
LinkDB All DBs
Position
C3615559:complement(3..434)
AA seq 144 aa AA seqDB search
TATFSSGVMLYGISFLYGQFGTLYFADIATKMEATPLVIMGLVFFFSGLGFKISLVPFHF
WTADTYQGAPTTVTGYLSVISKGAAAFTLLSILFHVFGDMMEYWHVLLMIVVVLSITIAN
LFAVRQNELKRFMAFSSISQAGYI

KEGG   T30383 (Metagenome): 92746Help
Entry
92746             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 152.91)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.92746-T1-C
LinkDB All DBs
Position
C3467365:3..299
AA seq 99 aa AA seqDB search
GAPTTITGYLSVVSKGAAAFALCTILMHVFGSLIEQWQYLLGIVIVLSITIANLFAIRQT
ELKRFMAFSSISQAGYIMLAVMGDSGMGVTALTYYILVY

KEGG   T30383 (Metagenome): 21950Help
Entry
21950             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ecor:SAMEA4412678_0047 (best score: 327.02)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.21950-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_20166:complement(2..523)
AA seq 174 aa AA seqDB search
LVGTAPKIAAAVFAFRILVTGLGALHTDWVPMLNMLALASLLVGNLAAVVQTNIKRMLAY
STVSHMGFVLLAFMGGLEGFSAALYYALTYALMALTGFGVLMLLSREGRDCEEIADLAGL
NQRHPWYAFLMLLVMFSMAGIPPLAGFYAKFSVLKALVGQGFVWPAVFAVVMSL

KEGG   T30383 (Metagenome): 38348Help
Entry
38348             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 216.083)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.38348-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_33430:3..401
AA seq 133 aa AA seqDB search
AVVFAFRILVTGLGTVHHDWSQMFAVLAVASLLVGNLAAIMQANIKRMLAYSTISHMGFI
LLAFMAGAVGFAAGLYYAITYALMAAVGFGILMVLSTDNIECEEIKDLAGLNQRHAWFAF
LMLLAMFSMAGIP

KEGG   T30383 (Metagenome): 237427Help
Entry
237427            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
lmir:NCTC12852_02113 (best score: 466.463)
Taxonomy
Betaproteobacteria [GN:lmir]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.237427-T1-C
LinkDB All DBs
Position
C3800898:2350..3087
AA seq 246 aa AA seqDB search
MAVSLTLHELNLAALAPEILLMLGICVFLVVEALTGRKERSMRADRMALLVLVAPLVAVL
WQYNHGPQQAFGHMYLADDLAYLLKVCGIVCTGSIIIYSRGYMADRGIRGADLYVLALFS
LLGQMVMISGGNLLVLYLGLELMSLSLYAAIGLRRNWTQGTEAAMKYFVLGALASGFLLY
GMSMVYGATGSLDIAEIMGRVYSGMASPQVLAFGMVFLVAGLAFKLGAVPFHMWVPDVYH
GAPTVA

KEGG   T30383 (Metagenome): 13022Help
Entry
13022             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 160.614)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.13022-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_12259:25..396
AA seq 124 aa AA seqDB search
MNWTDLNLIPAMPEIVLLTALCAVLLVDLWLKDNSRVITHYLSLFTLVLTAATQWYVWTP
TAVSTFNDMYLADGLSQLGKMTMYAALFAVFVYAKPYNRARNMFNGEFYTLSLFALLGMS
VMVS

KEGG   T30383 (Metagenome): 54062Help
Entry
54062             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
smur:BWP33_00410 (best score: 184.111)
Taxonomy
Betaproteobacteria [GN:smur]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.54062-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_45299:1..399
AA seq 133 aa AA seqDB search
GFSAGLYYALTYIVMALVGFGVLMLLSDESFECENIADLAGLNRRNAWYAFLMLLAMFSM
AGIPPLMGFYAKLQVIKLLVSANYTWLAVFAVVMSLIGAFYYLRVVRTIYFEEPADSRRL
SSDGAMKVLLSAN

KEGG   T30383 (Metagenome): 85100Help
Entry
85100             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
ecor:SAMEA4412678_0047 (best score: 118.242)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.85100-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_62966:1..219
AA seq 72 aa AA seqDB search
VFAVVMSLIGAFYYLRVVKVMYMDESAEPAQAPAMCAGGRVVLSACALALLLFGLMPSLL
MDWCVYALAKTF

KEGG   T30383 (Metagenome): 175086Help
Entry
175086            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
kki:KKKWG1_0378 (best score: 83.1889)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.175086-T1-C
LinkDB All DBs
Position
C3670483:complement(351..536)
AA seq 61 aa AA seqDB search
AFYYLRVVRVMYFEDATQHEPMSGTLAAKWVLSVNALLLLVWGVMPAHLTEWIKTAVERA
F

KEGG   T30383 (Metagenome): 50895Help
Entry
50895             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 200.29)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.50895-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_42985:complement(2..394)
AA seq 131 aa AA seqDB search
SVAAFIGTAPKIAAVMFAFRILLTGFGEVHQYWAPMFAVLAVASLVVGNLAAIMQTNIKR
MLAYSTVSHMGFILLAFMAGSIGATAGLYYAITYALMAAAGFGILMVLSNDNIECEEIKD
LAGLNQRHAWF

KEGG   T30383 (Metagenome): 114180Help
Entry
114180            CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 194.897)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.114180-T1-C
LinkDB All DBs
Position
C3521852:3..335
AA seq 111 aa AA seqDB search
QRHAWFALLMLLVMFSMAGIPPLMGFYAKFGVIMVLLKFHHVWLSVFAVVMSLIGAFYYL
RVVKVMYFDEPTHDQPVGSNYAAKLFLSVNAFLLVLWGVMPQTMIDWCARA

KEGG   T30383 (Metagenome): 5532Help
Entry
5532              CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 379.407)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.5532-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_5209:798..1640
AA seq 280 aa AA seqDB search
LGALASGLLLYGISMVYGATGSLDFASVLASAFNEQANEWLLKLGMVFIVVAIAFKLGAV
PFHMWVPDVYDGAPTSVTAFVGTAPKIAAVVFAFRILVTGMGTIHSDWAPMLAILAVASL
VVGNLAAIMQTNIKRMLAYSTVSHMGFILLAFMAGAVGFTAGLYYAITYALMAAVSFGVL
MVLSTKDIECENIKDLAGLNHRHAWFAFLMLLSMFSMAGIPPLMGFXXXXXXCPDGQCLP
AAPLGYHAANRYRLVCQSIGKYPVSFKQNQRRLFQSRRFC

KEGG   T30383 (Metagenome): 22221Help
Entry
22221             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
pru:PRU_1712 (best score: 160.999)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.22221-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_20384:complement(2..310)
AA seq 103 aa AA seqDB search
APTTITGYLSVVSKGAAAFTLCTILMRVFGSLIDQWQYLLGIVIVLSITIANLFAIRQTE
LKRFMAFSSISQAGYIMLAVMGDSGMGVTALTYYILVYVVANM

KEGG   T30383 (Metagenome): 35837Help
Entry
35837             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
kki:KKKWG1_0378 (best score: 234.572)
Taxonomy
Betaproteobacteria [GN:kki]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.35837-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_31437:complement(3..506)
AA seq 168 aa AA seqDB search
VPKIAATLFAFRILVSGLVLNKGDWQLLFAALAALSLLVGNLAAIMQTNVKRMFGFSTVS
HMGFVLLGFVGGQIGFQAAVFYAIIYTLMSLTGFGVLMAVSNEHHECNQISDLVGLNQRH
AWYAFLMLLALFSMAGIPPLAGFYAKFAVLKALVAAQYPWATLLAVFA

KEGG   T30383 (Metagenome): 72493Help
Entry
72493             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
kki:KKKWG1_0378 (best score: 322.013)
Taxonomy
Betaproteobacteria [GN:kki]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.72493-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_57119:complement(1..687)
AA seq 229 aa AA seqDB search
MDWTSLNLSAATPEIVLLIGLFGVLLLDLWLSDNNRFITHGLSIVVMLAAAGAQLATWVH
EPITAFHGFYIADGISQAAKLAMYLATAALFVYAKPYNQLRGIFKGEYYTLAMFACXXXX
XXXXMIALQRDSARAAEAALKYFVLGALASGILLYGASMVYGATGSLNFAEIFQAAQSGD
VNGWLLKLGVLFIVAAVAFKFGAVPFHMWVPDVYQGAPTSVGAFIGSVP

KEGG   T30383 (Metagenome): 50407Help
Entry
50407             CDS       T30383                                 

Gene name
nuoN
Definition
NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Best hit
nme:NMB0259 (best score: 228.794)
Taxonomy
Betaproteobacteria [GN:nme]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.50407-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_42568:complement(1..501)
AA seq 167 aa AA seqDB search
GMSVMVSAGHFLVAYIGLELLSLSLYAMIALRRDSARSAEAALKYFVLGALASGLLLYGI
SMIYGATGSLNFAIVLANGQSGVANGWLMKLGLVFVVVALAFKLGAVPFHMWVPDVYEGA
PTSVASIIGTAPKMAAAVFAFRILVTAMNNQHADWTQMLVILSVASL

DBGET integrated database retrieval system