KEGG   T30383 (Metagenome): 81979Help
Entry
81979             CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
nis:NIS_0299 (best score: 135.961)
Taxonomy
Epsilonproteobacteria [GN:nis]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.81979-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_61747:complement(4474..4776)
AA seq 100 aa AA seqDB search
MIGLTHYLILASLVFVIGLIGIMRRKNLIMLFFSSEILLNSANIALAAISKYHFDLTGQI
VAFFIVAIAASEVAVGLGLLVLWYKKTGSISLESMTNMKG

KEGG   T30383 (Metagenome): 67335Help
Entry
67335             CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
ecor:SAMEA4412678_0053 kki:KKKWG1_0373 (best score: 165.236)
Taxonomy
Betaproteobacteria [GN:ecor]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.67335-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_54234:complement(23..328)
AA seq 101 aa AA seqDB search
MITLTHYLVLAALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNFNFIAFSQYLGDTAGQ
VFVFFVLTVAAAESAIGLAIMVLVFRNRNSIDISDLDSLKG

KEGG   T30383 (Metagenome): 220520Help
Entry
220520            CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
pru:PRU_1715 (best score: 144.436)
Taxonomy
Bacteroidetes [GN:pru]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.220520-T1-C
LinkDB All DBs
Position
C3770325:complement(437..745)
AA seq 102 aa AA seqDB search
MIPVGYFFVLSGLLFFIGVFGFVTRRNLVAMLISVELVLNSVDINFAAFNRLLFPDGYEG
MFFTLFSIGVSAAESAVALAIIINVYRHFHSDQVNSIENMKL

KEGG   T30383 (Metagenome): 128790Help
Entry
128790            CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
ppc:HMPREF9154_2399 (best score: 62.3882)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.128790-T1-C
LinkDB All DBs
Position
C3558147:3..104
AA seq 33 aa AA seqDB search
VAAAEVVVGLAIIVAVYRARRSASVDDANLLKF

KEGG   T30383 (Metagenome): 223202Help
Entry
223202            CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
ppc:HMPREF9154_2399 (best score: 107.457)
Taxonomy
Actinobacteria [GN:ppc]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.223202-T1-C
LinkDB All DBs
Position
C3775703:1051..1254
AA seq 68 aa AA seqDB search
VSTEAYLVLAALLFAVGALGFLLRRNAIIAFMSVELMLNAANLVFVTFARQHGGLDGQVA
SFFVMVVA

KEGG   T30383 (Metagenome): 1158Help
Entry
1158              CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
actt:DDD63_09455 (best score: 136.346)
Taxonomy
Actinobacteria [GN:actt]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.1158-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_1086:complement(609..908)
AA seq 99 aa AA seqDB search
VNLMFYVALAMILFAIGGAAVLTRRNAIIALLGVEMMLNSCNLALVTFSRMWGNVEGQVV
SFFVMVVAAAEVVVGLAVVVAVFRTHRSASLDGANQLKH

KEGG   T30383 (Metagenome): 66073Help
Entry
66073             CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
lmir:NCTC12852_02116 (best score: 205.682)
Taxonomy
Betaproteobacteria [GN:lmir]Taxonomy
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.66073-T1-C
LinkDB All DBs
Position
SRS018665_WUGC_scaffold_53472:120..443
AA seq 107 aa AA seqDB search
MTADFLQLGLAHYLTLGAILFSIGVVGIFLNRRNLIVVLMSIELMLLAVNMNFVAFSHYM
GDLAGQIFVFFILTVAAAESAIGLAILVVLFRQFHSVNVEDLDHLRG

KEGG   T30383 (Metagenome): 151909Help
Entry
151909            CDS       T30383                                 

Gene name
nuoK
Definition
NADH-quinone oxidoreductase subunit K
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:7.1.1.2]
Best hit
gth:Geoth_3794 (best score: 66.2402)
Pathway
00190  Oxidative phosphorylation
01100  Metabolic pathways
Other DBs
HMP: SRS018665.151909-T1-C
LinkDB All DBs
Position
C3615129:complement(240..431)
AA seq 63 aa AA seqDB search
LNAVNINLIAFDRFYAHNTEGQLMALFSIAVAASEIAVGLALAFRLYRLRFTTNVDEVDA
LRD

DBGET integrated database retrieval system