KEGG   T30397 (Metagenome): 1025
Entry
1025              CDS       T30397                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
psei:GCE65_10425 gez:FE251_05090 (best score: 53.1434)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1025-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_2946:complement(223..327)
AA seq 35 aa
HEEVVLGNPGEQLTIRTDSFDRASFMPXXXXXXXX

KEGG   T30397 (Metagenome): 10546
Entry
10546             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
rmu:RMDY18_14640 (best score: 46.2098)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10546-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16804:3..134
AA seq 44 aa
ATEEATRKKRGERMSEKIWKVAVLGAAGRMGSEAVRAXXXXXXX

KEGG   T30397 (Metagenome): 10547
Entry
10547             CDS       T30397                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
rmu:RMDY18_14640 (best score: 83.1889)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10547-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16804:199..330
AA seq 44 aa
XTTGWTPERLDSLRELLGEHPGVGVLIAPNFAIGSILATEFAAK

KEGG   T30397 (Metagenome): 21107
Entry
21107             CDS       T30397                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
vpr:Vpar_0928 (best score: 96.2857)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.21107-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24564:2..145
AA seq 47 aa
VLFGGYDETLTIRHDSLSRLSFMPGVVLACKKISSKTGLTYGLEHYL

KEGG   T30397 (Metagenome): 24260
Entry
24260             CDS       T30397                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
vpr:Vpar_0928 (best score: 275.789)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.24260-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26768:complement(1340..1792)
AA seq 150 aa
XNANCLVAPNFSLGAVMMMKVSAELAPYFPNVEIIELHHNHKYDAPSGTSILTAKLINEA
KQAANATAAEDLTRESLPGARGAKVDDVTIHSVRLPGYVAHQEVLFGGYDETLTIRHDSL
SRLSFMPGVVLACKKISTKAGLTYGLEHYL

KEGG   T30397 (Metagenome): 29823
Entry
29823             CDS       T30397                                 

Gene name
dapB
Definition
dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Best hit
ach:Achl_1450 aai:AARI_10770 (best score: 41.5874)
Pathway
00261  Monobactam biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29823-T1-C
LinkDB
Position
C911213:complement(3..104)
AA seq 34 aa
MVEATQTKIRRVAVLGASGRMGSEAVKAITDAPD

DBGET integrated database retrieval system