KEGG   T30397 (Metagenome): 10487
Entry
10487             CDS       T30397                                 

Definition
acetylornithine transaminase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 208.379)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10487-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16753:1..360
AA seq 119 aa
AGAHATTFGGNPICAAAGNTIISRLTPELLDSVKAKGEYVKATLTGKPGVLGVSGMGLML
GIETTVDAKGVIAKCLEKGVVCLSAKNKVRLLPALNIPQEQLEKAIAILADVIEELAAQ

KEGG   T30397 (Metagenome): 1751
Entry
1751              CDS       T30397                                 

Gene name
argD
Definition
aminotransferase, acetylornithine/succinylornithine family
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 69.707)
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1751-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_4839:complement(2..103)
AA seq 34 aa
XRTGSLYAYQQFGIEPDVVSTAKGLAGGLPMGAT

KEGG   T30397 (Metagenome): 1752
Entry
1752              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 81.6481)
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.1752-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_4839:complement(197..325)
AA seq 43 aa
SFHGRTITTLSATGQDVFHQHFFPFTEGFIHTPANDXXXXXXX

KEGG   T30397 (Metagenome): 27454
Entry
27454             CDS       T30397                                 

Definition
acetylornithine and succinylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 379.022)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.27454-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28911:3..566
AA seq 188 aa
SFHGRTITTLSATGQEVFHQHFFPFTEGFIHTPANDIDAALKVLDNPAVCAIMMEPIQGE
GGVMPLDKEFVQAVTKYAHEHDQLVLIDEVQTGNGRTGSLYAYQQFGIEPDVVSTAKGLA
GGLPMGATLFNEKMQYVLNAGAHATTFGGNPICAAAGNTIISRLTPEFLDSVKVKGEYVK
STLTGKPG

KEGG   T30397 (Metagenome): 30883
Entry
30883             CDS       T30397                                 

Definition
acetylornithine and succinylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 144.05)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.30883-T1-C
LinkDB
Position
C914603:complement(203..436)
AA seq 77 aa
TLTGKPGVIGVSGMGLMLGIETTVDAKAVIAKCLEKGVVCLSAKNKVRLLPALNIPQEQL
EKAVRILAEVIEELAEK

KEGG   T30397 (Metagenome): 3997
Entry
3997              CDS       T30397                                 

Definition
acetylornithine transaminase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 61.6178)
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.3997-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9997:complement(2..103)
AA seq 34 aa
XLDSVKAKGEYVKETLTDKPGVIGVSGMGLMLGI

KEGG   T30397 (Metagenome): 3998
Entry
3998              CDS       T30397                                 

Gene name
argD
Definition
aminotransferase, acetylornithine/succinylornithine family
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
vpr:Vpar_1305 (best score: 98.5969)
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.3998-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9997:complement(148..309)
AA seq 54 aa
QTGNGRTGSLYAYQQFGIEPDVVSTAKGLAGGLPMGATLFNEKMQYVXXXXXXX

KEGG   T30397 (Metagenome): 8144
Entry
8144              CDS       T30397                                 

Definition
acetylornithine/succinylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Best hit
acq:AM609_07895 (best score: 50.8322)
Pathway
00220  Arginine biosynthesis
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8144-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14945:complement(2..115)
AA seq 38 aa
XXXPAQVGLAEELVRLTFPNRPAHDSRVFLANSGTEAN

DBGET integrated database retrieval system