KEGG   T30397 (Metagenome): 10561
Entry
10561             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Best hit
led:BBK82_09640 (best score: 172.94)
Taxonomy
Actinobacteria [GN:led]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.10561-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16815:1..348
AA seq 116 aa
HLLSHRLVKPHGLNLDGVFGLLANVVWTNHGPCLPAGFXXXXXXXXXXXXXXXYGVDKFP
RMVDYVMPTGVRIGDADRVRLGAHLAEGTTVMHEGFVNFNAGTLGNSMVXXXXXXX

KEGG   T30397 (Metagenome): 8915
Entry
8915              CDS       T30397                                 

Gene name
dapD
Definition
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Best hit
rmu:RMDY18_06050 (best score: 76.2553)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8915-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15526:complement(1..120)
AA seq 40 aa
XXXXGDRLRLGAHLASGTTVMHEGFVNFNAGTLGTSMVEG

KEGG   T30397 (Metagenome): 8916
Entry
8916              CDS       T30397                                 

Gene name
dapD
Definition
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Best hit
rmu:RMDY18_06050 (best score: 125.176)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.8916-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15526:complement(202..408)
AA seq 69 aa
VRTASINLDEAPEDALDAYLRLHLLSHTLVRPNELNLDGLFGTLANVAWTNHGPVLAAEF
QKXXXXXXX

DBGET integrated database retrieval system