KEGG   T30397 (Metagenome): 10734
Entry
10734             CDS       T30397                                 

Gene name
gnd
Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 76.6405)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.10734-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16938:complement(3..122)
AA seq 40 aa
XXXAPVDSVIEQLTPLLDEGDIIIDGGNSHFPDTIRRERA

KEGG   T30397 (Metagenome): 10735
Entry
10735             CDS       T30397                                 

Gene name
gnd
Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 134.42)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.10735-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16938:complement(157..384)
AA seq 76 aa
MTENKKAQIGVTGLAVMGANLARNLARNGYTVALHNRSAEKTDALLAEHGAEGDFIRTES
LQELVDSLESXXXXXX

KEGG   T30397 (Metagenome): 14905
Entry
14905             CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 88.9669)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.14905-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20073:complement(2..130)
AA seq 43 aa
XKLVAYAQGMDLLTRAGKEYGWDLKLDTIASLWRAGCIIRAEL

KEGG   T30397 (Metagenome): 14906
Entry
14906             CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 114.005)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.14906-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20073:complement(187..399)
AA seq 71 aa
XXXXPLVDVIVDAAGQKGTGLWTAKAGLDLGSPVSAIAESVFARALSSVDREQREQAQRE
LPAGXXXXXXX

KEGG   T30397 (Metagenome): 14907
Entry
14907             CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
rmu:RMDY18_07920 (best score: 116.701)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.14907-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20073:complement(423..599)
AA seq 59 aa
KHIGPMLEKIAAKAPQDGAPCCAWISTDGSGHFVKMVHNGIEYADMQVIGEAYXXXXXX

KEGG   T30397 (Metagenome): 26448
Entry
26448             CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
hin:HI0553 (best score: 154.836)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.26448-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28254:2..247
AA seq 82 aa
HEAWPYVKPIFQAISAKTEQGEPCCDWVGGEGAGHFVKMVHNGIEYGDMQLICEAYQFLK
EGLGLSYEEMQAIFXXXXXXXX

KEGG   T30397 (Metagenome): 26449
Entry
26449             CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
hso:HS_1654 paet:NCTC13378_01892 apag:EIA51_01355 hap:HAPS_0833
(best score: 48.1358)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.26449-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28254:294..362
AA seq 23 aa
XSEWKKTELDSYLIDITTDILGY

KEGG   T30397 (Metagenome): 3567
Entry
3567              CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 80.8777)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.3567-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_9098:complement(234..350)
AA seq 38 aa
NSGANLIQAQRDYFGAHTFERTDKEGSYHYDWVGNNGK

KEGG   T30397 (Metagenome): 4264
Entry
4264              CDS       T30397                                 

Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
haa:A5892_14850 (best score: 54.6842)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.4264-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10527:complement(3..107)
AA seq 35 aa
XXXLNIESRGYSVSIYNRTTSKTDEVIALHPDKKL

KEGG   T30397 (Metagenome): 4668
Entry
4668              CDS       T30397                                 

Definition
phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
xii:AMD24_00281 (best score: 59.6918)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.4668-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11269:223..345
AA seq 41 aa
XXXXIVIDGGNSNWEDSERREAELRNRGIYFVGCGISGGEE

KEGG   T30397 (Metagenome): 9074
Entry
9074              CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
spn:SP_0375 (best score: 101.679)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.9074-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15651:complement(548..685)
AA seq 45 aa
TYFDSYRSADLPANLIQAQRDYFGAHTYQRKDKEGTFHYSWYDEK

KEGG   T30397 (Metagenome): 9611
Entry
9611              CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 62.3882)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.9611-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16070:3..131
AA seq 43 aa
RDALFISKIVSYAQGFKLLQAAEKEYNWTFDYAQIAXXXXXXX

KEGG   T30397 (Metagenome): 9612
Entry
9612              CDS       T30397                                 

Gene name
gnd
Definition
6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Best hit
got:AXE85_01785 (best score: 60.077)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.9612-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_16070:238..327
AA seq 30 aa
MTSAVSYLDIYTTANSGANLIQAQRDYFGA

DBGET integrated database retrieval system