KEGG   T30397 (Metagenome): 11272
Entry
11272             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
cgl:NCgl1514 (best score: 66.2402)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.11272-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17348:1..132
AA seq 44 aa
RDVIQNHLIQLLALVAMEEPIDFTPAELQAEKMKVLRAXXXXXX

KEGG   T30397 (Metagenome): 15651
Entry
15651             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 92.8189)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.15651-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20609:complement(1..141)
AA seq 47 aa
XXXXPRHEEVELSWKILDPFEEYWEEHHIKPEPYESGSWGPRSADEM

KEGG   T30397 (Metagenome): 15652
Entry
15652             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 125.561)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.15652-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20609:complement(229..477)
AA seq 83 aa
XXXRAGKRLGRRVTEIAVIFKKPARSLFGEIENAHVGQNAIVIRVQPDEGMTIRFSAKVP
GTQMEIRDVNMDFGYGXXXXXXX

KEGG   T30397 (Metagenome): 15653
Entry
15653             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 125.946)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.15653-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20609:complement(509..715)
AA seq 69 aa
NHLLQLLALTAMEEPLSLDAKHLRAEKAKVLEAVRIDDLPNSFAVGQYSAGYQGGEHVNG
FFDXXXXXX

KEGG   T30397 (Metagenome): 17981
Entry
17981             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
jeo:JMA_20600 (best score: 66.2402)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.17981-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_22299:1..162
AA seq 54 aa
YGPSVDGLKPGYREDANVADDSNMETYVAGKVFIDNERWEGVPFYVXXXXXXXX

KEGG   T30397 (Metagenome): 21942
Entry
21942             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
jep:BW721_04075 (best score: 59.6918)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.21942-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25149:3..173
AA seq 57 aa
SKAVGNTIALQTSHLEKIFDENFAMSSPEAYERLILDCIEGDMTNFTHWEEXXXXXX

KEGG   T30397 (Metagenome): 24613
Entry
24613             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
jep:BW721_04075 (best score: 70.0922)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.24613-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27015:1..201
AA seq 67 aa
PKEGFCFVINSKAVGNTYGLQTSHLEKIFDKNFGLNSPEAYERLILDCMEGDMTNFTHWE
XXXXXXX

KEGG   T30397 (Metagenome): 24846
Entry
24846             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 120.553)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.24846-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27173:2..208
AA seq 69 aa
PWSDDDFRNYVRESVEANARTPFREDVWNQFQQGMRFVEGAFDDDAAFEKLKSTLAELDE
RXXXXXXXX

KEGG   T30397 (Metagenome): 24847
Entry
24847             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
rmu:RMDY18_10950 (best score: 139.428)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.24847-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27173:270..482
AA seq 71 aa
XXXXESARELNSIVEAVFPPDAVFRIDHYLGKETVQNILAMRFSNQMFEPLWNSHYVDHV
QITMAEDIGIG

KEGG   T30397 (Metagenome): 29068
Entry
29068             CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, NAD binding domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 215.698)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.29068-T1-C
LinkDB
Position
C908702:complement(3..329)
AA seq 109 aa
TIFGASGDLAKRKLYPSLFRLYKSGNLSEHFAVIGTARRPWSKEYFESVVVESILDLADS
TEQAQEFASHFYYQSHDVNDTEHYIALRQLQAELNDKYQAEHNKLFFLS

KEGG   T30397 (Metagenome): 7045
Entry
7045              CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
amy:ADJ76_03025 (best score: 68.9366)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.7045-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14027:complement(3..116)
AA seq 38 aa
XXXXVIRVQPDEGLTLKLGAKVPGTSMQVRDVTMDFAY

KEGG   T30397 (Metagenome): 7046
Entry
7046              CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
amy:ADJ76_03025 (best score: 52.373)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.7046-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14027:complement(221..310)
AA seq 30 aa
STTETFAAIKLFVDTRRWAGVPFYXXXXXX

KEGG   T30397 (Metagenome): 8332
Entry
8332              CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase, C-terminal domain
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
acq:AM609_06535 (best score: 68.5514)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.8332-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15088:complement(245..382)
AA seq 46 aa
IQPDEGITLRLASKVPGTQMELRDVSMDFGYGATFNEEXXXXXXXX

KEGG   T30397 (Metagenome): 8492
Entry
8492              CDS       T30397                                 

Gene name
zwf
Definition
glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Best hit
spn:SP_1243 (best score: 78.5666)
Pathway
00030  Pentose phosphate pathway
00480  Glutathione metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.8492-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15201:3..128
AA seq 42 aa
NGAPLYDYKAGSMGPQASFDLLEKFGAKWTWQPDIXXXXXXX

DBGET integrated database retrieval system