KEGG   T30397 (Metagenome): 11354
Entry
11354             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
fhw:RN87_06600 (best score: 124.79)
Taxonomy
Fusobacteria [GN:fhw]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11354-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17405:1..204
AA seq 68 aa
VKLMTRGGGDVTGAIVASLANADVYENWTDVSGVLMADPRIIPNPLPIEVINYNELRELS
YMXXXXXX

KEGG   T30397 (Metagenome): 12007
Entry
12007             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 104.76)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.12007-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17924:211..381
AA seq 57 aa
XVVDTQKAGNDVVVVVSAMGDTTDELLDLAAEVTSNVVPSRELDMLLTAGERISTAV

KEGG   T30397 (Metagenome): 19543
Entry
19543             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
vpr:Vpar_1126 (best score: 93.2041)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19543-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23445:complement(2..148)
AA seq 49 aa
XVDIEAVNIDEKMAKVSIIGAGMLGQPGVAAQMFDILSQEGINIEIIST

KEGG   T30397 (Metagenome): 19544
Entry
19544             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
vpr:Vpar_1126 (best score: 38.891)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.19544-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23445:complement(260..343)
AA seq 28 aa
GVENKPGVAATVFKALAAKNXXXXXXXX

KEGG   T30397 (Metagenome): 22245
Entry
22245             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 70.0922)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22245-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25373:complement(32..139)
AA seq 35 aa
VITELSKLDEAVRAVHTAFGLDTEGEATVYGGTGR

KEGG   T30397 (Metagenome): 22246
Entry
22246             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 234.958)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22246-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25373:complement(136..564)
AA seq 142 aa
TPTHLKEIPLEQPLISGVAHDRTRAKITVVGVPDVPGSAAKVFGLINEAKVNLDMIVQNV
PTDRPGVTDISFTLNQAQGPTALKALEDAKAELGFQEVIYNESVGKLSLVGAGMKTNPGV
SFTFXXXXXXXXXXXPLRFVFR

KEGG   T30397 (Metagenome): 25750
Entry
25750             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 129.413)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25750-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27796:2..223
AA seq 74 aa
NDLGAKAQSFTGSQAGMITDGVHGSARLVEVRPDRIRESIEAGNIAIVAGFQGMNRQSGD
ITTLGRGXXXXXXX

KEGG   T30397 (Metagenome): 25751
Entry
25751             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
rmu:RMDY18_17740 (best score: 186.808)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.25751-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27796:274..576
AA seq 101 aa
XXXXEIYSDVDGVFTADPRIVPTAHKLDTITSEEMLEMAANGAKILHLRSVEYARRFNLK
LHVRSSFSDLEGTIVVPEESAELTPIHLKEIPLEQPLISGV

KEGG   T30397 (Metagenome): 26762
Entry
26762             CDS       T30397                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 289.271)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.26762-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28465:complement(193..672)
AA seq 160 aa
LEKISKSIRALATLPIEDNEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYVHPREAGIV
VTSEPGNARIIPSSYDKIEGLADSNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAG
VKADLYENFTDVDGIFAAHPGIIHQPHSIPELXXXXXXXX

KEGG   T30397 (Metagenome): 28880
Entry
28880             CDS       T30397                                 

Gene name
lysC
Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
spn:SP_0413 (best score: 213.772)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.28880-T1-C
LinkDB
Position
C908028:complement(2..322)
AA seq 107 aa
REMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLEHSSDKFPVVGIAG
DSGFVSINMSKYLMNREVGFGRKVLQILEDLNIGWEHMPTGIDDLSI

KEGG   T30397 (Metagenome): 31900
Entry
31900             CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
vpr:Vpar_1126 (best score: 383.645)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.31900-T1-C
LinkDB
Position
C917589:1..582
AA seq 194 aa
MAMAFNERGQESVSLTGDQAGITSSDTFNKGRILGVDPNRVFEALDEGKIVVVAGFQGIT
EYGDMVTLGRGGSDTTAVALAGAMKADVCEIFTDVDGVYSTDPRVAKEAFKLEEVTYGEM
LEMARLGAGVMQPRAVEMGFRYGVPIHVRSTFSDKPGTIIREDYTVEANKHVITGVADDT
NTAKVALVGVENKP

KEGG   T30397 (Metagenome): 5212
Entry
5212              CDS       T30397                                 

Definition
aspartokinase III
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 59.3066)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.5212-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12189:complement(2..103)
AA seq 34 aa
XDAQTQANCDNLLKPLIDRGELVITQGFIGREPG

KEGG   T30397 (Metagenome): 5213
Entry
5213              CDS       T30397                                 

Definition
aspartokinase III
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
hik:HifGL_001303 (best score: 67.0106)
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.5213-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12189:complement(187..354)
AA seq 56 aa
LENITALSEAASLATSKALTDEIISQGEMMSTQIFIEVLRELQTSATWXXXXXXXX

KEGG   T30397 (Metagenome): 7057
Entry
7057              CDS       T30397                                 

Definition
aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Best hit
amy:ADJ76_08480 (best score: 157.918)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00260  Glycine, serine and threonine metabolism
00261  Monobactam biosynthesis
00270  Cysteine and methionine metabolism
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01210  2-Oxocarboxylic acid metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.7057-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14035:1..318
AA seq 106 aa
EVGANIDMIVQNLPISDPTKANITFTLPEGDAQKAXXXXXXXXXXXXXXXXELRYNPNIG
KLSLVGVGMRTNPGVSARLFSALSDAGINIDLISTSEIRISVVTRL

DBGET integrated database retrieval system