KEGG   T30397 (Metagenome): 11661
Entry
11661             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Best hit
nvi:100120366 cek:D0B88_15880 (best score: 29.6462)
Pathway
00010  Glycolysis / Gluconeogenesis
00051  Fructose and mannose metabolism
00052  Galactose metabolism
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
00521  Streptomycin biosynthesis
00524  Neomycin, kanamycin and gentamicin biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
04066  HIF-1 signaling pathway
04910  Insulin signaling pathway
04930  Type II diabetes mellitus
04973  Carbohydrate digestion and absorption
05131  Shigellosis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.11661-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17655:complement(236..415)
AA seq 60 aa
TEAKIDPDLKKKIITSGTPNNDTPVLYTQCGSGKGAKITYKKGDKTEDIVRGSXXXXXXX

DBGET integrated database retrieval system