KEGG   T30397 (Metagenome): 1167
Entry
1167              CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
bth:BT_2124 (best score: 61.6178)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.1167-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_3330:complement(195..320)
AA seq 42 aa
TTTETALAFRLLKKQCEDQLGKENAKDVIVAITDEHXXXXXX

KEGG   T30397 (Metagenome): 15969
Entry
15969             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
rmu:RMDY18_05930 (best score: 48.9062)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.15969-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20837:complement(3..68)
AA seq 22 aa
VRNGEWTGVTGKRIETVVNIGI

KEGG   T30397 (Metagenome): 15970
Entry
15970             CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
rmu:RMDY18_05930 (best score: 90.5077)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.15970-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20837:complement(209..457)
AA seq 83 aa
MTTSIDPTTTSAWSALSAHHKALTPXXXXXXXXXXXXXXXPARAEKFSFTADELHVDLSK
NLITSETVELLLKLAXXXXXXXX

KEGG   T30397 (Metagenome): 17322
Entry
17322             CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
asx:CDL62_06960 (best score: 81.2629)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17322-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21830:complement(2..139)
AA seq 46 aa
XGVPNIRVSVPTLNEYYLGQLIYFFEKACGISGLIQEVNPFNQPGV

KEGG   T30397 (Metagenome): 17323
Entry
17323             CDS       T30397                                 

Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
pru:PRU_1785 (best score: 73.9442)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.17323-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21830:complement(187..327)
AA seq 47 aa
ERSIFETVISVEEPNAKVLFPHDEENLDGLNFLAGKRVDEXXXXXXX

KEGG   T30397 (Metagenome): 2242
Entry
2242              CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
got:AXE85_03160 (best score: 98.9821)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.2242-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_6097:214..405
AA seq 64 aa
XXXFNEQEVKNMEGYVKVAHDQLHNKTGIGSDFLGWVDLPTNYDKEEFARIKEASKKIXX
XXXX

KEGG   T30397 (Metagenome): 239
Entry
239               CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
sig:N596_06560 (best score: 69.3218)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.239-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_666:complement(1..111)
AA seq 37 aa
XXXXFTLGYTIYFFELAIALSGYLNGINPFDQPGVEA

KEGG   T30397 (Metagenome): 240
Entry
240               CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
spy:SPy_0215 sig:N596_06560 (best score: 120.168)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.240-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_666:complement(178..384)
AA seq 69 aa
IQEGTRILFETVVRVDKPRKNVLIPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDG
GVPXXXXXX

KEGG   T30397 (Metagenome): 24191
Entry
24191             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
vpr:Vpar_1232 (best score: 325.479)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.24191-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26728:965..1531
AA seq 188 aa
MMKQNWKRTLQGALLGAVLLAMAGCGSTNVMDTYSFGHQVIRAGQSEITIALPYEMGKST
KNMSDKGYPIDIYGSVTEHMVIEVEALRPGENKPLPTVDEYINHSKSEFAKVGATIKEES
VALEGASAKKLDVTVTSQGQIFRISQYVFLDHGVLWNIVYQYPEKDQVGADISKEIQNKI
QVTQQKEG

KEGG   T30397 (Metagenome): 27860
Entry
27860             CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
vpr:Vpar_0658 (best score: 542.732)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.27860-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_29151:3..872
AA seq 289 aa
NNYSAEERDGYPRMYFAGFNVDGDYLVGLIRTLECQAQKKGPDYKVMLVINSKSGSTIEP
MANFMILEKALQDRNINYEVIAVTDVSDDEHPTILRSMAIENNWKTYSIPYGVGGRFSVF
TEVGFVTAALVGFDIEGFLAGAASMDVACQEEDIFKNPGLLSALLKYIASERYGRIIEVF
MPYSEALHSLSDWYVQLLSESLGKMSNTCLPYGRTPVAAVGTMDMHAQVQEHQEGRLNKV
VQFIKVKDWKHNLIVPDSYSQYERLHSLSDVGIXXXXXXXXXXXXXVLT

KEGG   T30397 (Metagenome): 28129
Entry
28129             CDS       T30397                                 

Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
vpr:Vpar_0658 (best score: 208.764)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.28129-T1-C
LinkDB
Position
C905364:complement(1..300)
AA seq 100 aa
ANIYNESCIQERDVNNFERAIQNVWRHTNILRSTGFEEGHVSKDGLPEPVLFYQLPYISE
DGINTPDMLERLYELRDYARHNIDTVVSVGIGGSYLGSKV

KEGG   T30397 (Metagenome): 3038
Entry
3038              CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
vpi:BW732_00825 (best score: 211.075)
Taxonomy
Firmicutes - Bacilli [GN:vpi]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.3038-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_7974:complement(3..347)
AA seq 115 aa
YEPTLQYFSEWWKQLFGESEGKDFKGIYPSSANFSTDLHSLGQYIQEGRRNIFETVIKVG
KPNEEVTIPETEEDLDGLGYLQGKTMDFVNTKAFQGTLLAHTDGEVPNFVVNIPD

KEGG   T30397 (Metagenome): 30832
Entry
30832             CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
rmu:RMDY18_05930 (best score: 288.885)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.30832-T1-C
LinkDB
Position
C914461:complement(3..434)
AA seq 144 aa
TLETLTNARVAREWLISSLREAGALEGKDASEAVAKHFVAVSTALDKVAAFGIDPENAFG
FWDWVGGRYSVDSAIGTSLAIVFGPKVFAEFLAGFHAMDEHFRTAPLAQNVPVLMGLLNI
WNVNFLGAETHAVLPYDQYLHRFP

KEGG   T30397 (Metagenome): 5480
Entry
5480              CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
acq:AM609_06110 (best score: 137.502)
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5480-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12593:complement(145..384)
AA seq 80 aa
EGTAEEIVPARVFAGNKPTTSILAPALTPAVVGELIALYEHITFTQGIVWGIDSFDQWGV
ELGKKLALEIAPXXXXXXXX

KEGG   T30397 (Metagenome): 7221
Entry
7221              CDS       T30397                                 

Gene name
pgi
Definition
glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Best hit
ppc:HMPREF9154_2541 (best score: 68.5514)
Pathway
00010  Glycolysis / Gluconeogenesis
00030  Pentose phosphate pathway
00500  Starch and sucrose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.7221-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14164:184..333
AA seq 50 aa
XXXXQLADLHVDLSKNLINDDVLAALLELAEQVDLAERREAMFNGEHINI

DBGET integrated database retrieval system