KEGG   T30397 (Metagenome): 11848
Entry
11848             CDS       T30397                                 

Definition
diaminopimelate decarboxylase, PLP-binding
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 152.14)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.11848-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17800:169..432
AA seq 88 aa
XXXXYIYSRATLERHWHAFDSALGKHPHLICYAVKANSNIGILNVMAKLGSGFDIVSQGE
LERVLAAGGEASKVVFSGVAKSRAEIMR

KEGG   T30397 (Metagenome): 13731
Entry
13731             CDS       T30397                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gsa:FOC50_06230 (best score: 67.781)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13731-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19212:1..147
AA seq 49 aa
TEEDRPFELAEFLREYIEVVERESDNFGLDLTKVVIEPGRSXXXXXXXX

KEGG   T30397 (Metagenome): 13732
Entry
13732             CDS       T30397                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gsa:FOC50_06230 (best score: 73.9442)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13732-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19212:213..320
AA seq 36 aa
XGGVKKTFAGREYVFVDGGMADNPRYALYKAKYEAM

KEGG   T30397 (Metagenome): 15284
Entry
15284             CDS       T30397                                 

Definition
pyridoxal-dependent decarboxylase, C-terminal sheet domain
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gth:Geoth_1367 (best score: 48.1358)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.15284-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20337:3..152
AA seq 50 aa
HFDKEKNQIVSVVGKCCESGDIIVEDVKLQTVNVGEHIIVESXXXXXXXX

KEGG   T30397 (Metagenome): 22570
Entry
22570             CDS       T30397                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
amy:ADJ76_04960 (best score: 94.7449)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.22570-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25594:3..146
AA seq 47 aa
GAYGYSMASNYNMLTKPGVLAVEDGTARWFVRPQTVDHLLALDAGLE

KEGG   T30397 (Metagenome): 23664
Entry
23664             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gqu:AWC35_16515 (best score: 29.261)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.23664-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26360:complement(159..503)
AA seq 114 aa
GDGKNGDKKIVSTGQDLFTIYSNNSYSCTVTMLGCAWVQPLMYFTLNNVPMFRGSYLIEE
VSHKIEPGRFQTTFKGVRMANVQTRLNKSPLLLANNTSESGSEFTAANRVXLVK

KEGG   T30397 (Metagenome): 27258
Entry
27258             CDS       T30397                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
vpr:Vpar_1032 (best score: 291.582)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.27258-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28789:complement(2..421)
AA seq 140 aa
MNKKTVPFTSEQLENIIAQYPTPFHIYDEEGIIENMKSFINAFSWNKGFKQYFAVKATPN
PYIMRLLQKLGVGADCSSLAELILCEKVGITGHDIMFTSNDTPYVEYKKALEMGAIINLD
DITHIEYLEKNHGSLPDTFC

KEGG   T30397 (Metagenome): 29041
Entry
29041             CDS       T30397                                 

Definition
protein tabA
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 174.481)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.29041-T1-C
LinkDB
Position
C908610:73..330
AA seq 86 aa
MKTPFINKEDLEKIVAEFPTPFHLYDEKGIREKARAVNQAFSWNKGFKEYFAVKATPTPA
ILKILQEEGCGVDCSSYVELLMSHKL

KEGG   T30397 (Metagenome): 30464
Entry
30464             CDS       T30397                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
vpr:Vpar_1032 (best score: 280.026)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.30464-T1-C
LinkDB
Position
C913231:complement(1..402)
AA seq 134 aa
YLVSTAIHKKDIYRHYIGLDACMANLMRPALYGSYHHITVMGKENAPKDHVYDVTGSLCE
NNDKFAIQRELPKIDIGDRVIIHDAGAHGHSMGFNYNGKLRSAELLLHKDGSVTQIRRAE
TYDDLFGTLDFSNL

KEGG   T30397 (Metagenome): 4497
Entry
4497              CDS       T30397                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
lla:L0121 (best score: 55.4546)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4497-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10956:complement(2..103)
AA seq 34 aa
XLRSAEVLLQEDGQARLIRRAEKPEDYLATLYGF

KEGG   T30397 (Metagenome): 4498
Entry
4498              CDS       T30397                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 62.003)
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.4498-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10956:complement(201..314)
AA seq 38 aa
NDKFAKQRELPVTEIGDLLVIHDTGAHGFSMGXXXXXX

DBGET integrated database retrieval system