KEGG   T30397 (Metagenome): 12248
Entry
12248             CDS       T30397                                 

Gene name
coaX
Definition
type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Best hit
vpr:Vpar_0507 (best score: 75.0997)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.12248-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18099:complement(1..126)
AA seq 42 aa
XXXQAGMFYGYVGQVEGLVSRMKAEMGDPVTVVATGGLAQLI

KEGG   T30397 (Metagenome): 12249
Entry
12249             CDS       T30397                                 

Gene name
coaX
Definition
type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Best hit
vpr:Vpar_0507 (best score: 58.9214)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.12249-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18099:complement(204..320)
AA seq 39 aa
KGNGDYMGGVISPGVTISAEALFQRAAKLPRXXXXXXXX

KEGG   T30397 (Metagenome): 16334
Entry
16334             CDS       T30397                                 

Gene name
coaX
Definition
type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Best hit
pgi:PG_0447 (best score: 56.9954)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.16334-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21105:complement(387..533)
AA seq 49 aa
EGVSLLVIDLGTAITYEQISPKGEYTGGNISPGLYTRLKALNXXXXXXX

KEGG   T30397 (Metagenome): 28258
Entry
28258             CDS       T30397                                 

Gene name
coaX
Definition
type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Best hit
vpr:Vpar_0507 (best score: 135.961)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.28258-T1-C
LinkDB
Position
C905856:1..204
AA seq 67 aa
MQSGMFYGYVGQVEGLVSRMKAEMGDHVTVVATGGLAQLISSATDCIDHVEPMLTLEGLR
LIYERNK

DBGET integrated database retrieval system