KEGG   T30397 (Metagenome): 12461
Entry
12461             CDS       T30397                                 

Gene name
coaA
Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
spy:SPy_1233 (best score: 146.362)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.12461-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18271:complement(184..549)
AA seq 122 aa
IPVYSHEVYDIVPGEKQRVKAADFVIVEGINVFQNPQNERLYITDFFDFSIYVDAAVEDI
ESWYLDRFLKLLSFAQNDPNSYYHRFTQMPIGEVEAFAHQVWTSINLTNLQNYIXXXXXX
XX

KEGG   T30397 (Metagenome): 25836
Entry
25836             CDS       T30397                                 

Gene name
coaA
Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
psei:GCE65_13520 (best score: 90.5077)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.25836-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_27849:1..204
AA seq 67 aa
AFTQPDSYFRKYADIDDDVALAGAGQIWDTVNLPNLIENIEPTRARATLLLHKDANHHMD
YMRLRKE

KEGG   T30397 (Metagenome): 29784
Entry
29784             CDS       T30397                                 

Gene name
coaA
Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
spy:SPy_1233 (best score: 136.346)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.29784-T1-C
LinkDB
Position
C911087:1..309
AA seq 102 aa
ERLYITDFFDFSIYVDAAVDDIESWYLDRFLKMLSLAQNDPDSYYYRFTQMPIGEVESFA
HQVWTSINLTNLQNYIEPTRNRAEVILHKTKNHEIDEIYLKK

KEGG   T30397 (Metagenome): 30822
Entry
30822             CDS       T30397                                 

Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
amy:ADJ76_00545 (best score: 262.307)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.30822-T1-C
LinkDB
Position
C914429:1..426
AA seq 141 aa
SHVTYDIVPDTYIDVDRPDILIVEGLNVLQPPRSAPGSISVAVSDYFDFSIYVDADEKHI
EQWYVERFLKLRATAFTREDSFFKTYASLTDTEAVSTAHMVWNAINLPNLRENIQPTRER
ATLIFTKGADHRVESLAIRKD

KEGG   T30397 (Metagenome): 31102
Entry
31102             CDS       T30397                                 

Gene name
coaA
Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
spy:SPy_1233 (best score: 176.022)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.31102-T1-C
LinkDB
Position
C915341:complement(2..460)
AA seq 153 aa
SRNRFIFLAFYGMINKISRGKQMTNEFLHFEKISRQTWQSLHRKTTPPLTEEELESIKSF
NDQISLQDVTDVYLPLAHLIQIYKRTKDDLAFSKGIFLQRESKSQPFIIGVSGSVAVGKS
TTSRLLQILLSRTLTDATVELVTTDGFLYPNQT

KEGG   T30397 (Metagenome): 5191
Entry
5191              CDS       T30397                                 

Gene name
coaA
Definition
pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Best hit
rmu:RMDY18_05160 (best score: 315.849)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.5191-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12135:371..886
AA seq 172 aa
XXXALLSRWPSTPNVQLVTTDGFLYPKAELQRRGIMHRKGFPESYDRRALLEFVSKVKAG
AERVTAPKYSHLYYDIIPDELIEVTAPDVLILEGLNVLAPSHTEGPETSDLTLSDFFDFS
IYVDARTEDIERWYVDRFLALRSSAFTNPESYFKRYAELNDEQAVEVATGIW

DBGET integrated database retrieval system