KEGG   T30397 (Metagenome): 12549
Entry
12549             CDS       T30397                                 

Definition
malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Best hit
pru:PRU_2158 (best score: 166.392)
Taxonomy
Bacteroidetes [GN:pru]
Pathway
00020  Citrate cycle (TCA cycle)
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.12549-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18339:complement(1..315)
AA seq 105 aa
HTYGGHGEQMAVFASQVKVDGKPLSEMGLSAERWEEIKHHTVQGGSNIIKLRGRSSFQSP
AYNAVKMIEAAMGGEKFTLPAGCYVNDEKLGFKNVMMAMPTTIDA

KEGG   T30397 (Metagenome): 4306
Entry
4306              CDS       T30397                                 

Gene name
mdh
Definition
malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Best hit
amy:ADJ76_00935 (best score: 223.016)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00020  Citrate cycle (TCA cycle)
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.4306-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10624:205..552
AA seq 116 aa
XVTVTGAAGNIGYALLFRIASGQLFGPDVPVKLNLLEIPQAVKAAEGTAMELDDCAFPTL
VGVEIFDDVNRAFQGTNVAYLVGAMPRRKGMERADLLEANAGIFGPQGKAINDGAA

KEGG   T30397 (Metagenome): 19373
Entry
19373             CDS       T30397                                 

Definition
pepSY-associated TM helix family protein
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Best hit
pmz:HMPREF0659_A6614 (best score: 46.595)
Pathway
00020  Citrate cycle (TCA cycle)
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.19373-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23315:complement(1..147)
AA seq 49 aa
XGVHNKWHEVNMSLEDEEKFTDIASHGDTLVVLSRSFVYTSLPPYTQIQ

KEGG   T30397 (Metagenome): 4917
Entry
4917              CDS       T30397                                 

Definition
lactate/malate dehydrogenase, NAD binding domain protein
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Best hit
pru:PRU_2158 (best score: 94.7449)
Pathway
00020  Citrate cycle (TCA cycle)
00270  Cysteine and methionine metabolism
00620  Pyruvate metabolism
00630  Glyoxylate and dicarboxylate metabolism
00680  Methane metabolism
00710  Carbon fixation in photosynthetic organisms
00720  Carbon fixation pathways in prokaryotes
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.4917-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_11704:192..335
AA seq 48 aa
XAADFGENIKKYCPDVKHVVVIFNPADVTALTALIHSGLKANQLTSLA

DBGET integrated database retrieval system