KEGG   T30397 (Metagenome): 12667
Entry
12667             CDS       T30397                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
cale:FDN13_01665 hor:Hore_04890 (best score: 66.2402)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.12667-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18431:188..418
AA seq 76 aa
XXXTWLVYVDRDVQVERFMKRDHLSKEVAESRLAAQWSLEEKTKLASRILDNNGSRDQLV
SQVVKLLEGGDSCARD

KEGG   T30397 (Metagenome): 24366
Entry
24366             CDS       T30397                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
gez:FE251_08035 (best score: 79.3369)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.24366-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26842:3..197
AA seq 65 aa
CLLKERGAVVTSADEVARDVVSPGSDGLAAVVAEFGEGILAPDGSLDRSALGRLVFSDXX
XXXXX

KEGG   T30397 (Metagenome): 26307
Entry
26307             CDS       T30397                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
rmu:RMDY18_11480 (best score: 138.272)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.26307-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28170:2..235
AA seq 78 aa
ARIVFHDEQARLRLNAIVHPAIRERAAQLVEQAQSEPGFSGVVLEDIPLLVETGDPSAFE
GVVVVRTPLATRXXXXXX

KEGG   T30397 (Metagenome): 32937
Entry
32937             CDS       T30397                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
vpr:Vpar_0779 (best score: 369.007)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.32937-T1-C
LinkDB
Position
C919906:152..754
AA seq 200 aa
MFKIGLTGGIASGKSTVLTYFKDKGIPYIDADIVAREVVEPGTKGLEAVVDAFGTDVLHD
DGTLNREALGAIVFHNAKKRQQLNGCLKEHIQNRIMELTAHYEELHTPVLLYDIPLLIEG
EWYTMMDEVWLVYVNESTQIERLMSRNGLTEEEALARINSQMRLEDKRSYADVIIDNNGT
PLNLREQLDNIWDERIESVL

KEGG   T30397 (Metagenome): 6330
Entry
6330              CDS       T30397                                 

Gene name
coaE
Definition
dephospho-coA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Best hit
pcw:110215785 (best score: 40.817)
Pathway
00770  Pantothenate and CoA biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS019024.6330-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_13399:complement(3..110)
AA seq 36 aa
XXXVHQLQKPGGRLFQALVQHFGQKIILENGELNRP

DBGET integrated database retrieval system