KEGG   T30397 (Metagenome): 13262
Entry
13262             CDS       T30397                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
dpm:FNV33_06265 (best score: 75.0997)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.13262-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18858:complement(183..341)
AA seq 53 aa
MKRTKIVCTIGPASEAPEKLAALAEAGMNVARLNFSHGDHEEHLARXXXXXXX

KEGG   T30397 (Metagenome): 16741
Entry
16741             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 79.7221)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16741-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21401:192..323
AA seq 44 aa
XXXRLRPETPVVAFTTSSKVRSFLSMLWGVEAEQVEMITDQEAI

KEGG   T30397 (Metagenome): 29276
Entry
29276             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
spy:SPy_1282 (best score: 204.912)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.29276-T1-C
LinkDB
Position
C909339:1..336
AA seq 112 aa
SFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEV
PFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVI

KEGG   T30397 (Metagenome): 30242
Entry
30242             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 237.269)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.30242-T1-C
LinkDB
Position
C912531:complement(2..388)
AA seq 129 aa
EGTKELSSVNYKGLTGDVSVGDKVLLADGLVTLVIDAIEGNNIVTTVQNSGEIGNRKRVA
VPGIALSLPPVSEQDEADLRFGCQQGVDFVAASFMQRGKDIVAIRRILESEKKDIKIIAK
IENAEGVKN

KEGG   T30397 (Metagenome): 11930
Entry
11930             CDS       T30397                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
capr:EQM14_07490 lbw:C3V36_05265 fma:FMG_1001 (best score: 48.1358)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.11930-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17860:complement(3..125)
AA seq 40 aa
XXXEAKKRDLVSEGDTVILTAGLPLGVSGNTNMIRVMEVI

KEGG   T30397 (Metagenome): 16990
Entry
16990             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pru:PRU_0684 (best score: 83.5741)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16990-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21594:complement(3..137)
AA seq 45 aa
XEHNSDIKIISKIENQEGVDNIDEIIDASYGIMIARGDLGIEVPI

KEGG   T30397 (Metagenome): 16799
Entry
16799             CDS       T30397                                 

Definition
hypothetical protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 45.0542)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16799-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21445:complement(1..69)
AA seq 23 aa
MLSGETANGAYPVEAVTTMTRIA

KEGG   T30397 (Metagenome): 1979
Entry
1979              CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pru:PRU_0684 (best score: 63.5438)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.1979-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5442:3..116
AA seq 38 aa
IKIISKIENQEGVDNIDEIIDASYGIMIARGDXXXXXX

KEGG   T30397 (Metagenome): 8547
Entry
8547              CDS       T30397                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
spy:SPy_1282 (best score: 49.2914)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.8547-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15245:3..125
AA seq 41 aa
ERKAVEAGLVESGDDIVIVAGVPLGEAVRTNTMRIXXXXXX

KEGG   T30397 (Metagenome): 13261
Entry
13261             CDS       T30397                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
crn:CAR_c10110 (best score: 67.3958)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.13261-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18858:complement(2..133)
AA seq 44 aa
XXXXTKGPEIRTHDMENGAIEFHTGDVVRISMTEVLGTKEKFSI

KEGG   T30397 (Metagenome): 28834
Entry
28834             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 165.236)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.28834-T1-C
LinkDB
Position
C907840:complement(3..320)
AA seq 106 aa
IAFTNIDIIRNERSNLGGAFIGGKMKRTKIVCTVGPGTDKFGILEDMMRAGMNVARFNFS
HGSHEEQAERMQMVRDAAMIVNKPIALMLDTKGPEVRLGLFKEGKV

KEGG   T30397 (Metagenome): 21423
Entry
21423             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 275.404)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.21423-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24780:complement(165..623)
AA seq 153 aa
EGVKNIDEILEVADGLMVARGDLGVEIPAEEVPVLQKMMIEKCNNLGKPVITATQMLESM
IQNPRPTRAEASDVANAILDGTDAIMLSGETANGSYPVEAVATMTRIAEVTEKAAIYDSY
SRAREDEEMTTTSAVCLASVRVAQNXXXXXXXX

KEGG   T30397 (Metagenome): 4104
Entry
4104              CDS       T30397                                 

Gene name
pyk
Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
lpl:lp_1897 (best score: 60.077)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.4104-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_10230:complement(173..319)
AA seq 49 aa
NLKVKTIVAATESGHTPKMISKFRPDATILGVTSSERQQRALAXXXXXX

KEGG   T30397 (Metagenome): 16800
Entry
16800             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
vpr:Vpar_1405 (best score: 66.6254)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16800-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21445:complement(235..366)
AA seq 44 aa
DVSVGDKILLADGLVTLTIDAIEGNNIITTVQNSGEXXXXXXXX

KEGG   T30397 (Metagenome): 27487
Entry
27487             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 168.703)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.27487-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28936:complement(2..346)
AA seq 115 aa
MSGKSVVTFPEKPAFPLMGCAKQHTKVRYMRRAKIVATIGPAIESPEKISEAIKAGLNVA
RLNMSHGDHAEHQARYNTIREQSAKLGKDVAILADLQGPKIRLERFANGKEYLEP

KEGG   T30397 (Metagenome): 12257
Entry
12257             CDS       T30397                                 

Definition
pyruvate kinase, alpha/beta domain protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
acq:AM609_05875 (best score: 79.7221)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.12257-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18105:complement(177..335)
AA seq 53 aa
PLPLLAFTPLHETRNQLAVSWGVQCYEVPEVQHTDEMVAQVDEILQDXXXXXX

KEGG   T30397 (Metagenome): 16740
Entry
16740             CDS       T30397                                 

Gene name
pyk
Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
rmu:RMDY18_08360 (best score: 89.7373)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16740-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21401:1..153
AA seq 51 aa
QDTEKGGLYRVPELDRKPRTRGGAITRAAVNIADQLDAKLIVTFXXXXXXX

KEGG   T30397 (Metagenome): 16991
Entry
16991             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pru:PRU_0684 (best score: 73.559)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.16991-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_21594:complement(201..368)
AA seq 56 aa
AGPMLVAQVQNEGDLGSHKSVNVPGEHIELPALTEKDKANILLAIEEDIXXXXXXX

KEGG   T30397 (Metagenome): 28240
Entry
28240             CDS       T30397                                 

Definition
pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
lmoi:VV02_14250 (best score: 169.474)
Taxonomy
Actinobacteria [GN:lmoi]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.28240-T1-C
LinkDB
Position
C905788:1..303
AA seq 101 aa
KGINLPGVAVSVPALSEKDREDLRWALKIGADLIALSFVRDADDIKDVHEIMDEVGVRIP
VIAKIEKPQAVENLFDIVSTFDGIMVARGDLGVEMPLEAVP

KEGG   T30397 (Metagenome): 1980
Entry
1980              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
pdi:BDI_3302 pru:PRU_0684 tfo:BFO_1460 bth:BT_2841 (best score:
51.6026)
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.1980-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_5442:219..302
AA seq 28 aa
XXXXPRPTRAEVTDIANAIYYRTDALML

DBGET integrated database retrieval system