KEGG   T30397 (Metagenome): 13340
Entry
13340             CDS       T30397                                 

Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
rmu:RMDY18_00220 (best score: 160.614)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.13340-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_18912:801..1052
AA seq 84 aa
XGHLKGWFTYVAGVAWAMNQEGGRDIMLPDAFGADLLINSRVPVGGGLSSSAALECSTAL
ALLELSCPLRPDCSETDAAPADND

KEGG   T30397 (Metagenome): 19438
Entry
19438             CDS       T30397                                 

Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
rmu:RMDY18_00220 (best score: 135.576)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.19438-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23364:complement(391..630)
AA seq 80 aa
APADNDTLRARLAQVCITAENKVAGAQTGGLDQTASLRSFPEQALVVDFRDFSIEPVRVD
IAQHGLSFLVIDTXXXXXXX

KEGG   T30397 (Metagenome): 26595
Entry
26595             CDS       T30397                                 

Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
alq:C7Y71_001735 (best score: 131.724)
Taxonomy
Bacteroidetes [GN:alq]
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.26595-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_28356:complement(41..301)
AA seq 86 aa
ETHDGLSREYEVSCPELDFLVDVARDCGVSGARVMGGGFGGCTINLVSQELYANFIDKAR
KSYQEKFGKAPIVIDVVIGDGARKLC

KEGG   T30397 (Metagenome): 5456
Entry
5456              CDS       T30397                                 

Gene name
galK
Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
fnu:FN2107 (best score: 67.3958)
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.5456-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12555:3..116
AA seq 38 aa
NGEVKTFFSPGRVNLIGEHTDYNGGFVFPCALXXXXXX

KEGG   T30397 (Metagenome): 5457
Entry
5457              CDS       T30397                                 

Gene name
galK
Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
fnu:FN2107 (best score: 93.2041)
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.5457-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12555:210..353
AA seq 48 aa
XXXKREDKIFRMYSKNFENLGIIEFNLDNLVYEKKDDWANYPKGVIKT

KEGG   T30397 (Metagenome): 7848
Entry
7848              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
pary:A4V02_02575 (best score: 50.447)
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.7848-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14704:241..312
AA seq 24 aa
XGVTGSRIMGGGFGGCTINLVKDN

KEGG   T30397 (Metagenome): 809
Entry
809               CDS       T30397                                 

Gene name
galK
Definition
galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Best hit
aap:NT05HA_1258 (best score: 211.46)
Taxonomy
Gammaproteobacteria - Others [GN:aap]
Pathway
00052  Galactose metabolism
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
Other DBs
HMP: SRS019024.809-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_2287:1..387
AA seq 129 aa
KAENKFVGANCGNMDQLISALGQKDHLLMIDCRXXXXEYNTRRWQCEKAAEFFGVKALRD
VSVEEFQKREAELTALNPLVAKRARHVVTENQRVLDAVEALKHNDLTKLGELMRQSHESM
RDDFEITVP

DBGET integrated database retrieval system